eF-site ID 3pcf-P PDB Code 3pcf Chain P click to enlarge Title STRUCTURE OF PROTOCATECHUATE 3,4-DIOXYGENASE COMPLEXED WITH 3-FLURO-4-HYDROXYBENZOATE Classification DIOXYGENASE Compound PROTOCATECHUATE 3,4-DIOXYGENASE Source ORGANISM_SCIENTIFIC: Pseudomonas putida; Sequence P:  PAQDNSRFVIRDRNWHPKALTPDYKTSIARSPRQALVSIP QSISETTGPNFSHLGFGAHDHDLLLNFGLPIGERIIVAGR VVDQYGKPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNF GGVGRCLTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHF GISGPSIATKLITQLYFEGDPLIPMCPIVKSIANPEAVQQ LIAKLDMNNANPMDCLAYRFDIVLRGQRKTHFE Description Functional site 1) chain P residue 324 type sequence Y description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 2) chain P residue 326 type sequence T description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 3) chain P residue 400 type sequence W description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 4) chain P residue 408 type sequence Y description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 5) chain P residue 447 type sequence Y description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 6) chain P residue 448 type sequence P description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 7) chain P residue 449 type sequence W description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 8) chain P residue 450 type sequence R description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 9) chain P residue 457 type sequence R description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 10) chain P residue 460 type sequence H description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 11) chain P residue 462 type sequence H description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 12) chain P residue 477 type sequence Q description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 13) chain P residue 491 type sequence I description SITE "ACD" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : ACD 14) chain P residue 304 type sequence D description SITE "VED" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : VED 15) chain P residue 307 type sequence R description SITE "VED" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : VED 16) chain P residue 339 type sequence I description SITE "VED" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : VED 17) chain P residue 340 type sequence P description SITE "VED" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : VED 18) chain P residue 341 type sequence Q description SITE "VED" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : VED 19) chain P residue 342 type sequence S description SITE "VED" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : VED 20) chain P residue 343 type sequence I description SITE "VED" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : VED 21) chain P residue 344 type sequence S description SITE "VED" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : VED 22) chain P residue 345 type sequence E description SITE "VED" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS D AND P. source : VED 23) chain P residue 318 type sequence K description SECONDARY THREE-FOLD SITE BETWEEN P, Q, R CHAINS. source : S2P 24) chain P residue 320 type sequence L description SECONDARY THREE-FOLD SITE BETWEEN P, Q, R CHAINS. source : S2P 25) chain P residue 322 type sequence P description SECONDARY THREE-FOLD SITE BETWEEN P, Q, R CHAINS. source : S2P 26) chain P residue 328 type sequence I description SECONDARY THREE-FOLD SITE BETWEEN P, Q, R CHAINS. source : S2P 27) chain P residue 332 type sequence P description SECONDARY THREE-FOLD SITE BETWEEN P, Q, R CHAINS. source : S2P 28) chain P residue 333 type sequence R description SECONDARY THREE-FOLD SITE BETWEEN P, Q, R CHAINS. source : S2P 29) chain P residue 334 type sequence Q description SECONDARY THREE-FOLD SITE BETWEEN P, Q, R CHAINS. source : S2P 30) chain P residue 408 type sequence Y description BINDING SITE FOR RESIDUE FE P 600 source : AC4 31) chain P residue 447 type sequence Y description BINDING SITE FOR RESIDUE FE P 600 source : AC4 32) chain P residue 460 type sequence H description BINDING SITE FOR RESIDUE FE P 600 source : AC4 33) chain P residue 462 type sequence H description BINDING SITE FOR RESIDUE FE P 600 source : AC4 34) chain P residue 361 type sequence H description BINDING SITE FOR RESIDUE BME P 601 source : BC7 35) chain P residue 429 type sequence C description BINDING SITE FOR RESIDUE BME P 601 source : BC7 36) chain P residue 430 type sequence L description BINDING SITE FOR RESIDUE BME P 601 source : BC7 37) chain P residue 438 type sequence S description BINDING SITE FOR RESIDUE BME P 601 source : BC7 38) chain P residue 324 type sequence Y description BINDING SITE FOR RESIDUE FHB P 550 source : BC8 39) chain P residue 408 type sequence Y description BINDING SITE FOR RESIDUE FHB P 550 source : BC8 40) chain P residue 447 type sequence Y description BINDING SITE FOR RESIDUE FHB P 550 source : BC8 41) chain P residue 449 type sequence W description BINDING SITE FOR RESIDUE FHB P 550 source : BC8 42) chain P residue 457 type sequence R description BINDING SITE FOR RESIDUE FHB P 550 source : BC8 43) chain P residue 460 type sequence H description BINDING SITE FOR RESIDUE FHB P 550 source : BC8 44) chain P residue 462 type sequence H description BINDING SITE FOR RESIDUE FHB P 550 source : BC8 45) chain P residue 477 type sequence Q description BINDING SITE FOR RESIDUE FHB P 550 source : BC8 46) chain P residue 491 type sequence I description BINDING SITE FOR RESIDUE FHB P 550 source : BC8 47) chain P residue 333 type sequence R description BINDING SITE FOR RESIDUE FHB P 551 source : BC9 48) chain P residue 328 type sequence I description BINDING SITE FOR RESIDUE FHB Q 551 source : CC3 49) chain P residue 409 type catalytic sequence R description 936 source MCSA : MCSA4 50) chain P residue 448 type catalytic sequence P description 936 source MCSA : MCSA4 51) chain P residue 458 type catalytic sequence P description 936 source MCSA : MCSA4 52) chain P residue 461 type catalytic sequence I description 936 source MCSA : MCSA4 53) chain P residue 463 type catalytic sequence F description 936 source MCSA : MCSA4 54) chain P residue 409 type BINDING sequence R description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 55) chain P residue 448 type BINDING sequence P description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 56) chain P residue 461 type BINDING sequence I description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 57) chain P residue 463 type BINDING sequence F description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links