eF-site ID 3pce-M PDB Code 3pce Chain M click to enlarge Title STRUCTURE OF PROTOCATECHUATE 3,4-DIOXYGENASE COMPLEXED WITH 3-HYDROXYPHENYLACETATE Classification DIOXYGENASE Compound PROTOCATECHUATE 3,4-DIOXYGENASE Source ORGANISM_SCIENTIFIC: Pseudomonas putida; Sequence M:  PAQDNSRFVIRDRNWHPKALTPDYKTSIARSPRQALVSIP QSISETTGPNFSHLGFGAHDHDLLLNFGLPIGERIIVAGR VVDQYGKPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNF GGVGRCLTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHF GISGPSIATKLITQLYFEGDPLIPMCPIVKSIANPEAVQQ LIAKLDMNNANPMDCLAYRFDIVLRGQRKTHFE Description Functional site 1) chain M residue 324 type sequence Y description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 2) chain M residue 326 type sequence T description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 3) chain M residue 408 type sequence Y description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 4) chain M residue 447 type sequence Y description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 5) chain M residue 449 type sequence W description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 6) chain M residue 450 type sequence R description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 7) chain M residue 457 type sequence R description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 8) chain M residue 460 type sequence H description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 9) chain M residue 462 type sequence H description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 10) chain M residue 477 type sequence Q description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 11) chain M residue 491 type sequence I description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 12) chain M residue 304 type sequence D description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 13) chain M residue 307 type sequence R description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 14) chain M residue 339 type sequence I description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 15) chain M residue 340 type sequence P description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 16) chain M residue 341 type sequence Q description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 17) chain M residue 342 type sequence S description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 18) chain M residue 343 type sequence I description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 19) chain M residue 344 type sequence S description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 20) chain M residue 345 type sequence E description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 21) chain M residue 408 type sequence Y description BINDING SITE FOR RESIDUE FE M 600 source : AC1 22) chain M residue 447 type sequence Y description BINDING SITE FOR RESIDUE FE M 600 source : AC1 23) chain M residue 460 type sequence H description BINDING SITE FOR RESIDUE FE M 600 source : AC1 24) chain M residue 462 type sequence H description BINDING SITE FOR RESIDUE FE M 600 source : AC1 25) chain M residue 361 type sequence H description BINDING SITE FOR RESIDUE BME M 601 source : AC7 26) chain M residue 429 type sequence C description BINDING SITE FOR RESIDUE BME M 601 source : AC7 27) chain M residue 430 type sequence L description BINDING SITE FOR RESIDUE BME M 601 source : AC7 28) chain M residue 438 type sequence S description BINDING SITE FOR RESIDUE BME M 601 source : AC7 29) chain M residue 408 type sequence Y description BINDING SITE FOR RESIDUE 3HP M 550 source : AC8 30) chain M residue 447 type sequence Y description BINDING SITE FOR RESIDUE 3HP M 550 source : AC8 31) chain M residue 449 type sequence W description BINDING SITE FOR RESIDUE 3HP M 550 source : AC8 32) chain M residue 457 type sequence R description BINDING SITE FOR RESIDUE 3HP M 550 source : AC8 33) chain M residue 462 type sequence H description BINDING SITE FOR RESIDUE 3HP M 550 source : AC8 34) chain M residue 491 type sequence I description BINDING SITE FOR RESIDUE 3HP M 550 source : AC8 35) chain M residue 409 type catalytic sequence R description 936 source MCSA : MCSA1 36) chain M residue 448 type catalytic sequence P description 936 source MCSA : MCSA1 37) chain M residue 458 type catalytic sequence P description 936 source MCSA : MCSA1 38) chain M residue 461 type catalytic sequence I description 936 source MCSA : MCSA1 39) chain M residue 463 type catalytic sequence F description 936 source MCSA : MCSA1 40) chain M residue 409 type BINDING sequence R description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 41) chain M residue 448 type BINDING sequence P description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 42) chain M residue 461 type BINDING sequence I description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 43) chain M residue 463 type BINDING sequence F description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 44) chain M residue 380-408 type prosite sequence VAGRVVDQYGKPVPNTLVEMWQANAGGRY description INTRADIOL_DIOXYGENAS Intradiol ring-cleavage dioxygenases signature. VaGrVvdqyGkpVpntlVEMwqanagGrY source prosite : PS00083

Display surface Download Links