eF-site ID 3p87-ABCDEFGHIJKL
PDB Code 3p87
Chain A, B, C, D, E, F, G, H, I, J, K, L

click to enlarge
Title Structure of human PCNA bound to RNASEH2B PIP box peptide
Classification HYDROLASE/DNA BINDING PROTEIN
Compound Proliferating cell nuclear antigen
Source Homo sapiens (Human) (RNH2B_HUMAN)
Sequence A:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM
DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDDTLALVFEAPNQEKVSDYEMKLMDLD
VEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISC
AKDGVKFSASGELGNGNIKLSQAVTIEMNEPVQLTFALRY
LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYL
APKIE
B:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM
DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDDTLALVFEAPNQEKVSDYEMKLMDLD
VEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISC
AKDGVKFSASGELGNGNIKLSQAVTIEMNEPVQLTFALRY
LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYL
APKIE
C:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM
DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDDTLALVFEAPNQEKVSDYEMKLMDLD
VEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISC
AKDGVKFSASGELGNGNIKLSQAVTIEMNEPVQLTFALRY
LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYL
APKIE
D:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM
DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDDTLALVFEAPNQEKVSDYEMKLMDLD
VEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISC
AKDGVKFSASGELGNGNIKLSQAVTIEMNEPVQLTFALRY
LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYL
APKIE
E:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM
DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDDTLALVFEAPNQEKVSDYEMKLMDLD
VEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISC
AKDGVKFSASGELGNGNIKLSQAVTIEMNEPVQLTFALRY
LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYL
APKIE
F:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM
DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDDTLALVFEAPNQEKVSDYEMKLMDLD
VEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISC
AKDGVKFSASGELGNGNIKLSQAVTIEMNEPVQLTFALRY
LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYL
APKIE
G:  KSGMKSIDTFF
H:  DKSGMKSIDTFF
I:  DKSGMKSIDTFF
J:  KSGMKSIDTFF
K:  DKSGMKSIDTFF
L:  KSGMKSIDTFF
Description (1)  Proliferating cell nuclear antigen, Ribonuclease H2 subunit B


Functional site

1) chain A
residue 61-80
type DNA_BIND
ligand
sequence RCDRNLAMGVNLTSMSKILK
description Potential.
source Swiss-Prot : SWS_FT_FI1

2) chain B
residue 61-80
type DNA_BIND
ligand
sequence RCDRNLAMGVNLTSMSKILK
description Potential.
source Swiss-Prot : SWS_FT_FI2

3) chain C
residue 61-80
type DNA_BIND
ligand
sequence RCDRNLAMGVNLTSMSKILK
description Potential.
source Swiss-Prot : SWS_FT_FI3

4) chain D
residue 61-80
type DNA_BIND
ligand
sequence RCDRNLAMGVNLTSMSKILK
description Potential.
source Swiss-Prot : SWS_FT_FI4

5) chain E
residue 61-80
type DNA_BIND
ligand
sequence RCDRNLAMGVNLTSMSKILK
description Potential.
source Swiss-Prot : SWS_FT_FI5

6) chain F
residue 61-80
type DNA_BIND
ligand
sequence RCDRNLAMGVNLTSMSKILK
description Potential.
source Swiss-Prot : SWS_FT_FI6


Display surface

Download
Links