eF-site ID 3p87-A
PDB Code 3p87
Chain A

click to enlarge
Title Structure of human PCNA bound to RNASEH2B PIP box peptide
Classification HYDROLASE/DNA BINDING PROTEIN
Compound Proliferating cell nuclear antigen
Source Homo sapiens (Human) (RNH2B_HUMAN)
Sequence A:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM
DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDDTLALVFEAPNQEKVSDYEMKLMDLD
VEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISC
AKDGVKFSASGELGNGNIKLSQAVTIEMNEPVQLTFALRY
LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYL
APKIE
Description (1)  Proliferating cell nuclear antigen, Ribonuclease H2 subunit B


Functional site

1) chain A
residue 61-80
type DNA_BIND
ligand
sequence RCDRNLAMGVNLTSMSKILK
description Potential.
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links