eF-site ID 3p33-H
PDB Code 3p33
Chain H

click to enlarge
Title Insulin fibrillation is the Janus face of induced fit. A chiral clamp stabilizes the native state at the expense of activity
Classification HORMONE
Compound Insulin
Source Homo sapiens (Human) (INS_HUMAN)
Sequence H:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  Insulin A chain, insulin B chain


Functional site

1) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN H 31
source : AC7

2) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN H 31
source : AC7

3) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN H 31
source : AC7

4) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL H 32
source : AC8

5) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL H 32
source : AC8

6) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL H 32
source : AC8

7) chain H
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH G 400
source : BC3

8) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH G 400
source : BC3

9) chain H
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH G 400
source : BC3

10) chain H
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_3p33_G_400

11) chain H
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_3p33_G_400

12) chain H
residue 14
type binding
ligand IPH: PHENOL
sequence A
description PHENOL binding site
source pdb_hetatom : IPH_3p33_G_400


Display surface

Download
Links