eF-site ID 3p33-F
PDB Code 3p33
Chain F

click to enlarge
Title Insulin fibrillation is the Janus face of induced fit. A chiral clamp stabilizes the native state at the expense of activity
Classification HORMONE
Compound Insulin
Source Homo sapiens (Human) (INS_HUMAN)
Sequence F:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  Insulin A chain, insulin B chain


Functional site

1) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN F 31
source : AC5

2) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN F 31
source : AC5

3) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN F 31
source : AC5

4) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL F 32
source : AC6

5) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL F 32
source : AC6

6) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL F 32
source : AC6

7) chain F
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH E 300
source : BC2

8) chain F
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH E 300
source : BC2


Display surface

Download
Links