eF-site ID 3p33-D
PDB Code 3p33
Chain D

click to enlarge
Title Insulin fibrillation is the Janus face of induced fit. A chiral clamp stabilizes the native state at the expense of activity
Classification HORMONE
Compound Insulin
Source Homo sapiens (Human) (INS_HUMAN)
Sequence D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  Insulin A chain, insulin B chain


Functional site

1) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 31
source : AC3

2) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 31
source : AC3

3) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 31
source : AC3

4) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL D 32
source : AC4

5) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL D 32
source : AC4

6) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL D 32
source : AC4

7) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH C 200
source : BC1

8) chain D
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_3p33_C_200

9) chain D
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_3p33_C_200

10) chain D
residue 14
type binding
ligand IPH: PHENOL
sequence A
description PHENOL binding site
source pdb_hetatom : IPH_3p33_C_200


Display surface

Download
Links