eF-site ID 3oo2-B
PDB Code 3oo2
Chain B

click to enlarge
Title 2.37 Angstrom resolution crystal structure of an alanine racemase (alr) from Staphylococcus aureus subsp. aureus COL
Classification ISOMERASE
Compound Alanine racemase 1
Source Staphylococcus aureus (strain COL) (ALR1_STAAC)
Sequence B:  SDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVVKAN
AYGLGSVKVARHLMENGATFFAVATLDEAIELRMHGITAK
ILVLGVLPAKDIDKAIQHRVALTVPSKQWLKEAIKNISKK
LWLHIKLDTGMGRLGIKDTKTYQEVIEIIQQYEQLVFEGV
FTHFACADEPGDMTTEQYQRFKDMVNEAIKPEYIHCQNSA
GSLLMDCQFCNAIRPGISLYGYYPSEYVQQKVKVHLKPSV
QLIANVVQTKTLQADPTTIALLPIGYADGYLRIMQGSFVN
VNGHQCEVIGRVCMDQTIVKVPDQVKAGDSVILIDNHRES
PQSVEVVAEKQHTINYEVLCNLSRRLPRIYHDGDQRFVTN
ELLK
Description (1)  Alanine racemase 1 (E.C.5.1.1.1)


Functional site

1) chain B
residue 309
type
ligand
sequence R
description BINDING SITE FOR RESIDUE BME A 384
source : AC2

2) chain B
residue 138
type
ligand
sequence R
description BINDING SITE FOR RESIDUE BME A 385
source : AC3

3) chain B
residue 154
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NA B 383
source : AC5

4) chain B
residue 157
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NA B 383
source : AC5

5) chain B
residue 160
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NA B 383
source : AC5

6) chain B
residue 309
type
ligand
sequence R
description BINDING SITE FOR RESIDUE BME B 384
source : AC6

7) chain B
residue 311
type
ligand
sequence C
description BINDING SITE FOR RESIDUE BME B 384
source : AC6

8) chain B
residue 43
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PO4 B 385
source : AC7

9) chain B
residue 203
type
ligand
sequence N
description BINDING SITE FOR RESIDUE PO4 B 385
source : AC7

10) chain B
residue 204
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PO4 B 385
source : AC7

11) chain B
residue 221
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 B 385
source : AC7

12) chain B
residue 222
type
ligand
sequence I
description BINDING SITE FOR RESIDUE PO4 B 385
source : AC7

13) chain B
residue 354
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PO4 B 385
source : AC7

14) chain B
residue 42
type ACT_SITE
ligand
sequence A
description Proton acceptor; specific for D-alanine. {ECO:0000255|HAMAP-Rule:MF_01201}.
source Swiss-Prot : SWS_FT_FI5

15) chain B
residue 315
type BINDING
ligand
sequence T
description Substrate; via amide nitrogen. {ECO:0000255|HAMAP-Rule:MF_01201}.
source Swiss-Prot : SWS_FT_FI7

16) chain B
residue 141
type BINDING
ligand
sequence I
description Substrate. {ECO:0000255|HAMAP- Rule:MF_01201}.
source Swiss-Prot : SWS_FT_FI8

17) chain B
residue 36-46
type prosite
ligand
sequence AVVKANAYGLG
description Alanine racemase pyridoxal-phosphate attachment site. [SACVLG]-[AIPTV]-x(0,1)-K-[ADGS]-[DEN]-[GA]-Y-G-[HACILN]-[GD]
source prosite : PS00395

18) chain B
residue 309
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence R
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_3oo2_A_384

19) chain B
residue 309-312
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence RVCM
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_3oo2_B_384

20) chain B
residue 138
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence R
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_3oo2_A_385

21) chain B
residue 170
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence A
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_3oo2_A_385


Display surface

Download
Links