eF-site ID 3onw-C
PDB Code 3onw
Chain C

click to enlarge
Title Structure of a G-alpha-i1 mutant with enhanced affinity for the RGS14 GoLoco motif.
Classification SIGNALING PROTEIN
Compound Guanine nucleotide-binding protein G(i) subunit alpha-1
Source Homo sapiens (Human) (RGS14_HUMAN)
Sequence C:  IEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ
Description (1)  Guanine nucleotide-binding protein G(i) subunit alpha-1 (E.C.3.6.5.1), Regulator of G-protein signaling 14


Functional site

1) chain C
residue 516
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

2) chain C
residue 516
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401


Display surface

Download
Links