eF-site ID 3onw-ABCD
PDB Code 3onw
Chain A, B, C, D

click to enlarge
Title Structure of a G-alpha-i1 mutant with enhanced affinity for the RGS14 GoLoco motif.
Classification SIGNALING PROTEIN
Compound Guanine nucleotide-binding protein G(i) subunit alpha-1
Source Homo sapiens (Human) (RGS14_HUMAN)
Sequence A:  REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKA
VVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLA
GAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYLLNDS
AAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTF
KDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYD
LVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKK
DLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLN
KRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNN
B:  REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKA
VVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLA
GAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYLLNDS
AAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTF
KDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYD
LVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKK
DLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLN
KRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL
C:  IEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ
D:  DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEF
Description (1)  Guanine nucleotide-binding protein G(i) subunit alpha-1 (E.C.3.6.5.1), Regulator of G-protein signaling 14


Functional site

1) chain A
residue 41
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

2) chain A
residue 43
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

3) chain A
residue 44
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

4) chain A
residue 45
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

5) chain A
residue 46
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

6) chain A
residue 47
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

7) chain A
residue 48
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

8) chain A
residue 150
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

9) chain A
residue 151
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

10) chain A
residue 176
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

11) chain A
residue 178
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

12) chain A
residue 269
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

13) chain A
residue 270
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

14) chain A
residue 272
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

15) chain A
residue 273
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

16) chain A
residue 325
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

17) chain A
residue 326
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

18) chain A
residue 327
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

19) chain C
residue 516
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

20) chain B
residue 41
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

21) chain B
residue 43
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

22) chain B
residue 44
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

23) chain B
residue 45
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

24) chain B
residue 46
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

25) chain B
residue 47
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

26) chain B
residue 48
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

27) chain B
residue 150
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

28) chain B
residue 151
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

29) chain B
residue 176
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

30) chain B
residue 178
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

31) chain B
residue 269
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

32) chain B
residue 270
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

33) chain B
residue 272
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

34) chain B
residue 273
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

35) chain B
residue 325
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

36) chain B
residue 326
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

37) chain B
residue 327
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

38) chain D
residue 516
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP B 401
source : AC2

39) chain B
residue 154
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 B 1
source : AC3

40) chain B
residue 172
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 B 1
source : AC3

41) chain B
residue 176
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 1
source : AC3

42) chain B
residue 242
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 2
source : AC4

43) chain D
residue 510
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 B 2
source : AC4

44) chain D
residue 511
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 B 2
source : AC4

45) chain A
residue 293
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 3
source : AC5

46) chain A
residue 294
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 3
source : AC5

47) chain A
residue 174-178
type NP_BIND
ligand
sequence VLRTR
description GTP.
source Swiss-Prot : SWS_FT_FI1

48) chain A
residue 243-246
type NP_BIND
ligand
sequence MHES
description GTP.
source Swiss-Prot : SWS_FT_FI1

49) chain B
residue 174-178
type NP_BIND
ligand
sequence VLRTR
description GTP.
source Swiss-Prot : SWS_FT_FI2

50) chain B
residue 243-246
type NP_BIND
ligand
sequence MHES
description GTP.
source Swiss-Prot : SWS_FT_FI2

51) chain A
residue 41-48
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence AGESGKST
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

52) chain A
residue 149-151
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NDS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

53) chain A
residue 175-176
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence LR
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

54) chain A
residue 178
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

55) chain A
residue 200
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence D
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

56) chain A
residue 269-273
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NKKDL
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

57) chain A
residue 324-327
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence TCAT
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

58) chain C
residue 516
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

59) chain B
residue 41-48
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence AGESGKST
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_B_401

60) chain B
residue 149-151
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NDS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_B_401

61) chain B
residue 175-176
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence LR
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_B_401

62) chain B
residue 178
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_B_401

63) chain B
residue 200
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence D
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_B_401

64) chain B
residue 269-273
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NKKDL
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_B_401

65) chain B
residue 324-327
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence TCAT
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_B_401

66) chain D
residue 516
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_B_401


Display surface

Download
Links