eF-site ID 3onw-A
PDB Code 3onw
Chain A

click to enlarge
Title Structure of a G-alpha-i1 mutant with enhanced affinity for the RGS14 GoLoco motif.
Classification SIGNALING PROTEIN
Compound Guanine nucleotide-binding protein G(i) subunit alpha-1
Source Homo sapiens (Human) (RGS14_HUMAN)
Sequence A:  REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKA
VVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLA
GAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYLLNDS
AAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTF
KDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYD
LVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKK
DLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLN
KRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNN
Description (1)  Guanine nucleotide-binding protein G(i) subunit alpha-1 (E.C.3.6.5.1), Regulator of G-protein signaling 14


Functional site

1) chain A
residue 41
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

2) chain A
residue 43
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

3) chain A
residue 44
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

4) chain A
residue 45
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

5) chain A
residue 46
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

6) chain A
residue 47
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

7) chain A
residue 48
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

8) chain A
residue 150
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

9) chain A
residue 151
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

10) chain A
residue 176
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

11) chain A
residue 178
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

12) chain A
residue 269
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

13) chain A
residue 270
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

14) chain A
residue 272
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

15) chain A
residue 273
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

16) chain A
residue 325
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

17) chain A
residue 326
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

18) chain A
residue 327
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

19) chain A
residue 293
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 3
source : AC5

20) chain A
residue 294
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 3
source : AC5

21) chain A
residue 174-178
type NP_BIND
ligand
sequence VLRTR
description GTP.
source Swiss-Prot : SWS_FT_FI1

22) chain A
residue 243-246
type NP_BIND
ligand
sequence MHES
description GTP.
source Swiss-Prot : SWS_FT_FI1

23) chain A
residue 41-48
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence AGESGKST
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

24) chain A
residue 149-151
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NDS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

25) chain A
residue 175-176
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence LR
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

26) chain A
residue 178
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

27) chain A
residue 200
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence D
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

28) chain A
residue 269-273
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NKKDL
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401

29) chain A
residue 324-327
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence TCAT
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_3onw_A_401


Display surface

Download
Links