eF-site ID 3oj4-F PDB Code 3oj4 Chain F click to enlarge Title Crystal structure of the A20 ZnF4, ubiquitin and UbcH5A complex Classification LIGASE/PROTEIN BINDING Compound Ubiquitin-conjugating enzyme E2 D1 Source Homo sapiens (Human) (TNAP3_HUMAN) Sequence F:  SKCRKAGCVYFGTPENKGFCTLCFIEYRENK Description Functional site 1) chain F residue 607 type sequence C description BINDING SITE FOR RESIDUE ZN F 900 source : AC2 2) chain F residue 612 type sequence C description BINDING SITE FOR RESIDUE ZN F 900 source : AC2 3) chain F residue 624 type sequence C description BINDING SITE FOR RESIDUE ZN F 900 source : AC2 4) chain F residue 627 type sequence C description BINDING SITE FOR RESIDUE ZN F 900 source : AC2 5) chain F residue 607 type SITE sequence C description Interacts with activating enzyme source Swiss-Prot : SWS_FT_FI1 6) chain F residue 612 type SITE sequence C description Interacts with activating enzyme source Swiss-Prot : SWS_FT_FI1 7) chain F residue 624 type SITE sequence C description Interacts with activating enzyme source Swiss-Prot : SWS_FT_FI1 8) chain F residue 627 type SITE sequence C description Interacts with activating enzyme source Swiss-Prot : SWS_FT_FI1

Display surface Download Links