eF-site ID 3oj3-L PDB Code 3oj3 Chain L click to enlarge Title Crystal structure of the A20 ZnF4 and ubiquitin complex Classification PROTEIN BINDING/HYDROLASE Compound Ubiquitin Source (TNAP3_HUMAN) Sequence L:  SKCRKAGCVYFGTPENKGFCTLCFIEYRENK Description Functional site 1) chain L residue 607 type sequence C description BINDING SITE FOR RESIDUE ZN L 904 source : AC4 2) chain L residue 612 type sequence C description BINDING SITE FOR RESIDUE ZN L 904 source : AC4 3) chain L residue 624 type sequence C description BINDING SITE FOR RESIDUE ZN L 904 source : AC4 4) chain L residue 627 type sequence C description BINDING SITE FOR RESIDUE ZN L 904 source : AC4 5) chain L residue 607 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 6) chain L residue 612 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 7) chain L residue 624 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 8) chain L residue 627 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links