eF-site ID 3oj3-K PDB Code 3oj3 Chain K click to enlarge Title Crystal structure of the A20 ZnF4 and ubiquitin complex Classification PROTEIN BINDING/HYDROLASE Compound Ubiquitin Source (TNAP3_HUMAN) Sequence K:  SKCRKAGCVYFGTPENKGFCTLCFIEYRENK Description Functional site 1) chain K residue 607 type sequence C description BINDING SITE FOR RESIDUE ZN K 903 source : AC3 2) chain K residue 612 type sequence C description BINDING SITE FOR RESIDUE ZN K 903 source : AC3 3) chain K residue 624 type sequence C description BINDING SITE FOR RESIDUE ZN K 903 source : AC3 4) chain K residue 627 type sequence C description BINDING SITE FOR RESIDUE ZN K 903 source : AC3 5) chain K residue 612 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 6) chain K residue 624 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 7) chain K residue 627 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 8) chain K residue 607 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links