eF-site ID 3o0j-A PDB Code 3o0j Chain A click to enlarge Title PDE4B In complex with ligand an2898 Classification HYDROLASE/HYDROLASE INHIBITOR Compound cAMP-specific 3',5'-cyclic phosphodiesterase 4B Source Homo sapiens (Human) (PDE4B_HUMAN) Sequence A:  NEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQ ERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAAD VAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGV SNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCD IFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMV ETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLE LYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEK SQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQ SMI Description Functional site 1) chain A residue 238 type sequence H description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 2) chain A residue 274 type sequence H description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 3) chain A residue 275 type sequence D description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 4) chain A residue 392 type sequence D description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 5) chain A residue 275 type sequence D description BINDING SITE FOR RESIDUE MG A 2 source : AC2 6) chain A residue 234 type sequence H description BINDING SITE FOR RESIDUE 3OJ A 485 source : AC3 7) chain A residue 238 type sequence H description BINDING SITE FOR RESIDUE 3OJ A 485 source : AC3 8) chain A residue 275 type sequence D description BINDING SITE FOR RESIDUE 3OJ A 485 source : AC3 9) chain A residue 347 type sequence M description BINDING SITE FOR RESIDUE 3OJ A 485 source : AC3 10) chain A residue 392 type sequence D description BINDING SITE FOR RESIDUE 3OJ A 485 source : AC3 11) chain A residue 431 type sequence M description BINDING SITE FOR RESIDUE 3OJ A 485 source : AC3 12) chain A residue 446 type sequence F description BINDING SITE FOR RESIDUE 3OJ A 485 source : AC3 13) chain A residue 208 type sequence T description BINDING SITE FOR RESIDUE EDO A 486 source : AC4 14) chain A residue 209 type sequence F description BINDING SITE FOR RESIDUE EDO A 486 source : AC4 15) chain A residue 325 type sequence N description BINDING SITE FOR RESIDUE EDO A 486 source : AC4 16) chain A residue 326 type sequence L description BINDING SITE FOR RESIDUE EDO A 486 source : AC4 17) chain A residue 330 type sequence Q description BINDING SITE FOR RESIDUE EDO A 486 source : AC4 18) chain A residue 210 type sequence R description BINDING SITE FOR RESIDUE EDO A 487 source : AC5 19) chain A residue 211 type sequence I description BINDING SITE FOR RESIDUE EDO A 487 source : AC5 20) chain A residue 212 type sequence S description BINDING SITE FOR RESIDUE EDO A 487 source : AC5 21) chain A residue 215 type sequence T description BINDING SITE FOR RESIDUE EDO A 487 source : AC5 22) chain A residue 321 type sequence D description BINDING SITE FOR RESIDUE EDO A 487 source : AC5 23) chain A residue 322 type sequence I description BINDING SITE FOR RESIDUE EDO A 487 source : AC5 24) chain A residue 324 type sequence M description BINDING SITE FOR RESIDUE EDO A 487 source : AC5 25) chain A residue 325 type sequence N description BINDING SITE FOR RESIDUE EDO A 487 source : AC5 26) chain A residue 251 type sequence S description BINDING SITE FOR RESIDUE EDO A 5 source : AC6 27) chain A residue 256 type sequence D description BINDING SITE FOR RESIDUE EDO A 5 source : AC6 28) chain A residue 249 type sequence L description BINDING SITE FOR RESIDUE EDO A 6 source : AC7 29) chain A residue 252 type sequence T description BINDING SITE FOR RESIDUE EDO A 6 source : AC7 30) chain A residue 458 type sequence W description BINDING SITE FOR RESIDUE EDO A 6 source : AC7 31) chain A residue 465 type sequence D description BINDING SITE FOR RESIDUE EDO A 6 source : AC7 32) chain A residue 469 type sequence I description BINDING SITE FOR RESIDUE EDO A 6 source : AC7 33) chain A residue 340 type sequence D description BINDING SITE FOR RESIDUE EDO A 7 source : AC8 34) chain A residue 349 type sequence K description BINDING SITE FOR RESIDUE EDO A 7 source : AC8 35) chain A residue 385 type sequence R description BINDING SITE FOR RESIDUE EDO A 7 source : AC8 36) chain A residue 293 type sequence L description BINDING SITE FOR RESIDUE EDO A 8 source : AC9 37) chain A residue 297 type sequence Y description BINDING SITE FOR RESIDUE EDO A 8 source : AC9 38) chain A residue 306 type sequence H description BINDING SITE FOR RESIDUE EDO A 8 source : AC9 39) chain A residue 280 type sequence G description BINDING SITE FOR RESIDUE EDO A 9 source : BC1 40) chain A residue 281 type sequence V description BINDING SITE FOR RESIDUE EDO A 9 source : BC1 41) chain A residue 413 type sequence E description BINDING SITE FOR RESIDUE EDO A 9 source : BC1 42) chain A residue 414 type sequence F description BINDING SITE FOR RESIDUE EDO A 9 source : BC1 43) chain A residue 417 type sequence Q description BINDING SITE FOR RESIDUE EDO A 9 source : BC1 44) chain A residue 212 type sequence S description BINDING SITE FOR RESIDUE EDO A 11 source : BC2 45) chain A residue 214 type sequence D description BINDING SITE FOR RESIDUE EDO A 11 source : BC2 46) chain A residue 215 type sequence T description BINDING SITE FOR RESIDUE EDO A 11 source : BC2 47) chain A residue 319 type sequence H description BINDING SITE FOR RESIDUE EDO A 11 source : BC2 48) chain A residue 331 type sequence R description BINDING SITE FOR RESIDUE EDO A 12 source : BC3 49) chain A residue 335 type sequence R description BINDING SITE FOR RESIDUE EDO A 12 source : BC3 50) chain A residue 202 type sequence E description BINDING SITE FOR RESIDUE EDO A 14 source : BC4 51) chain A residue 251 type sequence S description BINDING SITE FOR RESIDUE EDO A 14 source : BC4 52) chain A residue 250 type sequence L description BINDING SITE FOR RESIDUE EDO A 16 source : BC5 53) chain A residue 255 type sequence L description BINDING SITE FOR RESIDUE EDO A 16 source : BC5 54) chain A residue 257 type sequence A description BINDING SITE FOR RESIDUE EDO A 16 source : BC5 55) chain A residue 258 type sequence V description BINDING SITE FOR RESIDUE EDO A 16 source : BC5 56) chain A residue 259 type sequence F description BINDING SITE FOR RESIDUE EDO A 16 source : BC5 57) chain A residue 203 type sequence R description BINDING SITE FOR RESIDUE EDO A 17 source : BC6 58) chain A residue 204 type sequence D description BINDING SITE FOR RESIDUE EDO A 17 source : BC6 59) chain A residue 205 type sequence L description BINDING SITE FOR RESIDUE EDO A 17 source : BC6 60) chain A residue 208 type sequence T description BINDING SITE FOR RESIDUE EDO A 17 source : BC6 61) chain A residue 261 type sequence D description BINDING SITE FOR RESIDUE EDO A 17 source : BC6 62) chain A residue 264 type sequence I description BINDING SITE FOR RESIDUE EDO A 17 source : BC6 63) chain A residue 208 type sequence T description BINDING SITE FOR RESIDUE EDO A 18 source : BC7 64) chain A residue 261 type sequence D description BINDING SITE FOR RESIDUE EDO A 18 source : BC7 65) chain A residue 330 type sequence Q description BINDING SITE FOR RESIDUE EDO A 18 source : BC7 66) chain A residue 300 type sequence E description BINDING SITE FOR RESIDUE EDO A 19 source : BC8 67) chain A residue 349 type sequence K description BINDING SITE FOR RESIDUE EDO A 19 source : BC8 68) chain A residue 274-285 type prosite sequence HDVDHPGVSNQF description PDEASE_I_1 3'5'-cyclic nucleotide phosphodiesterase domain signature. HDVdHpGvsNqF source prosite : PS00126 69) chain A residue 234 type ACT_SITE sequence H description Proton donor => ECO:0000305|PubMed:15003452, ECO:0007744|PDB:1ROR source Swiss-Prot : SWS_FT_FI1 70) chain A residue 234 type BINDING sequence H description BINDING => ECO:0000269|PubMed:15003452, ECO:0000269|PubMed:15260978, ECO:0007744|PDB:1ROR, ECO:0007744|PDB:1TB5 source Swiss-Prot : SWS_FT_FI2 71) chain A residue 443 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:15003452, ECO:0000269|PubMed:15260978, ECO:0007744|PDB:1ROR, ECO:0007744|PDB:1TB5 source Swiss-Prot : SWS_FT_FI2 72) chain A residue 238 type BINDING sequence H description BINDING => ECO:0000269|PubMed:15003452, ECO:0000269|PubMed:15260978, ECO:0000269|PubMed:15576036, ECO:0000269|PubMed:15685167, ECO:0000269|PubMed:17727341, ECO:0000269|PubMed:18539455, ECO:0007744|PDB:1RO6, ECO:0007744|PDB:1RO9, ECO:0007744|PDB:1ROR, ECO:0007744|PDB:1TB5, ECO:0007744|PDB:1XLX, ECO:0007744|PDB:1XLZ, ECO:0007744|PDB:1XM4, ECO:0007744|PDB:1XM6, ECO:0007744|PDB:1XMU, ECO:0007744|PDB:1XMY, ECO:0007744|PDB:1XN0, ECO:0007744|PDB:1XOS, ECO:0007744|PDB:1XOT, ECO:0007744|PDB:1Y2H, ECO:0007744|PDB:1Y2J, ECO:0007744|PDB:2QYL, ECO:0007744|PDB:3D3P source Swiss-Prot : SWS_FT_FI3 73) chain A residue 274 type BINDING sequence H description BINDING => ECO:0000269|PubMed:10846163, ECO:0000269|PubMed:15003452, ECO:0000269|PubMed:15576036, ECO:0000269|PubMed:15685167, ECO:0000269|PubMed:17727341, ECO:0000269|PubMed:18539455, ECO:0007744|PDB:1F0J, ECO:0007744|PDB:1RO6, ECO:0007744|PDB:1RO9, ECO:0007744|PDB:1ROR, ECO:0007744|PDB:1XLX, ECO:0007744|PDB:1XLZ, ECO:0007744|PDB:1XM4, ECO:0007744|PDB:1XM6, ECO:0007744|PDB:1XMU, ECO:0007744|PDB:1XMY, ECO:0007744|PDB:1XN0, ECO:0007744|PDB:1XOS, ECO:0007744|PDB:1XOT, ECO:0007744|PDB:1Y2H, ECO:0007744|PDB:1Y2J, ECO:0007744|PDB:2QYL, ECO:0007744|PDB:3D3P source Swiss-Prot : SWS_FT_FI4 74) chain A residue 275 type BINDING sequence D description BINDING => ECO:0000269|PubMed:15003452, ECO:0007744|PDB:1ROR source Swiss-Prot : SWS_FT_FI5 75) chain A residue 446 type BINDING sequence F description BINDING => ECO:0000305|PubMed:15003452, ECO:0000305|PubMed:15260978, ECO:0007744|PDB:1ROR, ECO:0007744|PDB:1TB5 source Swiss-Prot : SWS_FT_FI7 76) chain A residue 392 type BINDING sequence D description BINDING => ECO:0000269|PubMed:10846163, ECO:0000269|PubMed:15003452, ECO:0000269|PubMed:15260978, ECO:0000269|PubMed:15576036, ECO:0000269|PubMed:15685167, ECO:0000269|PubMed:18539455, ECO:0007744|PDB:1F0J, ECO:0007744|PDB:1RO6, ECO:0007744|PDB:1RO9, ECO:0007744|PDB:1ROR, ECO:0007744|PDB:1TB5, ECO:0007744|PDB:1XLX, ECO:0007744|PDB:1XLZ, ECO:0007744|PDB:1XM4, ECO:0007744|PDB:1XM6, ECO:0007744|PDB:1XMU, ECO:0007744|PDB:1XMY, ECO:0007744|PDB:1XN0, ECO:0007744|PDB:1XOS, ECO:0007744|PDB:1XOT, ECO:0007744|PDB:1Y2H, ECO:0007744|PDB:1Y2J, ECO:0007744|PDB:3D3P source Swiss-Prot : SWS_FT_FI6

Display surface Download Links