eF-site ID 3nmp-C PDB Code 3nmp Chain C click to enlarge Title Crystal structure of the abscisic receptor PYL2 mutant A93F in complex with pyrabactin Classification hormone binding protein Compound Abscisic acid receptor PYL2 Source Arabidopsis thaliana (Mouse-ear cress) (PYL2_ARATH) Sequence C:  SEQKTLEPVIKTYHQFEPDPTTCTSLITQRIHAPASVVWP LIRRFDNPERYKHFVKRCRLISGDGDVGSVREVTVISGLP FSTSTERLEFVDDDHRVLSFRVVGGEHRLKNYKSVTSVNE FLNQDSGKVYTVVLESYTVDIPEGNTEEDTKMFVDTVVKL NLQKLGVAATSAPMHD Description Functional site 1) chain C residue 64 type sequence K description BINDING SITE FOR RESIDUE PYV C 900 source : AC3 2) chain C residue 85 type sequence V description BINDING SITE FOR RESIDUE PYV C 900 source : AC3 3) chain C residue 98 type sequence E description BINDING SITE FOR RESIDUE PYV C 900 source : AC3 4) chain C residue 114 type sequence V description BINDING SITE FOR RESIDUE PYV C 900 source : AC3 5) chain C residue 121 type sequence L description BINDING SITE FOR RESIDUE PYV C 900 source : AC3 6) chain C residue 124 type sequence Y description BINDING SITE FOR RESIDUE PYV C 900 source : AC3 7) chain C residue 169 type sequence V description BINDING SITE FOR RESIDUE PYV C 900 source : AC3 8) chain C residue 173 type sequence N description BINDING SITE FOR RESIDUE PYV C 900 source : AC3 9) chain C residue 93 type BINDING sequence F description BINDING => ECO:0000269|PubMed:19893533, ECO:0000269|PubMed:19898420 source Swiss-Prot : SWS_FT_FI1 10) chain C residue 120 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19893533, ECO:0000269|PubMed:19898420 source Swiss-Prot : SWS_FT_FI1 11) chain C residue 147 type BINDING sequence E description BINDING => ECO:0000269|PubMed:19893533, ECO:0000269|PubMed:19898420 source Swiss-Prot : SWS_FT_FI1 12) chain C residue 64 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19893533, ECO:0000269|PubMed:19898420 source Swiss-Prot : SWS_FT_FI1 13) chain C residue 92 type SITE sequence P description Involved in interactions with PP2Cs => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI2 14) chain C residue 158 type SITE sequence T description Involved in interactions with PP2Cs => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI2 15) chain C residue 166 type SITE sequence V description Involved in ABA binding => ECO:0000250|UniProtKB:Q84MC7 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links