eF-site ID 3nlu-A PDB Code 3nlu Chain A click to enlarge Title Structure of endothelial nitric oxide synthase heme domain complexed with N1-{(3'R,4'R)-4'-[(6"-amino-4"-methylpyridin-2"-yl)methyl]pyrrolidin-3'-yl}-N2-(3'-fluorophenethyl)ethane-1,2-diamine tetrahydrochloride Classification OXIDOREDUCTASE Compound Nitric oxide synthase, endothelial Source (NOS3_BOVIN) Sequence A:  GPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLV LPRPAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEA EVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQV FDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRA PGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCI QHGWTPGNGRFDVLPLLLQAPDEAPELFVLPPELVLEVPL EHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFSG WYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWK DKAAVEINLAVLHSFQLAKVTIVDHHAATVSFMKHLDNEQ KARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRY QPDPW Description Functional site 1) chain A residue 180 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 2) chain A residue 185 type sequence R description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 3) chain A residue 186 type sequence C description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 4) chain A residue 228 type sequence S description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 5) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 6) chain A residue 356 type sequence S description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 7) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 8) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 9) chain A residue 475 type sequence F description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 10) chain A residue 104 type sequence S description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 11) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 12) chain A residue 448 type sequence A description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 13) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 14) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE ACT A 860 source : AC3 15) chain A residue 428 type sequence S description BINDING SITE FOR RESIDUE ACT A 860 source : AC3 16) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE GOL A 880 source : AC4 17) chain A residue 373 type sequence H description BINDING SITE FOR RESIDUE GOL A 880 source : AC4 18) chain A residue 249 type sequence Q description BINDING SITE FOR RESIDUE 3XB A 800 source : AC5 19) chain A residue 338 type sequence V description BINDING SITE FOR RESIDUE 3XB A 800 source : AC5 20) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE 3XB A 800 source : AC5 21) chain A residue 357 type sequence G description BINDING SITE FOR RESIDUE 3XB A 800 source : AC5 22) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE 3XB A 800 source : AC5 23) chain A residue 359 type sequence Y description BINDING SITE FOR RESIDUE 3XB A 800 source : AC5 24) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE 3XB A 800 source : AC5 25) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE 3XB A 800 source : AC5 26) chain A residue 477 type sequence Y description BINDING SITE FOR RESIDUE 3XB A 800 source : AC5 27) chain A residue 384 type sequence C description BINDING SITE FOR RESIDUE CAD A 950 source : AC6 28) chain A residue 439 type sequence A description BINDING SITE FOR RESIDUE CAD A 950 source : AC6 29) chain A residue 440 type sequence R description BINDING SITE FOR RESIDUE CAD A 950 source : AC6 30) chain A residue 441 type sequence G description BINDING SITE FOR RESIDUE CAD A 950 source : AC6 31) chain A residue 96 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC7 32) chain A residue 101 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC7 33) chain A residue 447 type sequence W description BINDING SITE FOR RESIDUE H4B B 600 source : AC9 34) chain A residue 462 type sequence F description BINDING SITE FOR RESIDUE H4B B 600 source : AC9 35) chain A residue 185-192 type prosite sequence RCVGRIQW description NOS Nitric oxide synthase (NOS) signature. RCVGRIqW source prosite : PS60001 36) chain A residue 186 type BINDING sequence C description axial binding residue => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI3 37) chain A residue 96 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 101 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 39) chain A residue 104 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 249 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 41) chain A residue 477 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 42) chain A residue 358 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 43) chain A residue 359 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 44) chain A residue 363 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 368 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 46) chain A residue 448 type BINDING sequence A description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 47) chain A residue 449 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 48) chain A residue 462 type BINDING sequence F description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links