eF-site ID 3nhe-A PDB Code 3nhe Chain A click to enlarge Title High Resolution Structure (1.26A) of USP2a in Complex with Ubiquitin Classification Hydrolase/protein binding Compound Ubiquitin carboxyl-terminal hydrolase 2 Source Homo sapiens (Human) (UBIQ_HUMAN) Sequence A:  AQGLAGLRNLGNTXFMNSILQCLSNTRELRDYCLQRLYMR DLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQ IQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKS NPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLKSS LTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLF TKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHL KRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAVYN LYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMS SSQVRTSDAYLLFYELAS Description Functional site 1) chain A residue 425 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 2) chain A residue 428 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 3) chain A residue 476 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 4) chain A residue 479 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 5) chain A residue 428 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3 6) chain A residue 476 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 479 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3 8) chain A residue 268-283 type prosite sequence GLRNLGNTXFMNSILQ description USP_1 Ubiquitin specific protease (USP) domain signature 1. GLrnlGNtCFMNSiLQ source prosite : PS00972 9) chain A residue 541-558 type prosite sequence YNLYAVSNHSGTTMGGHY description USP_2 Ubiquitin specific protease (USP) domain signature 2. YnLyAVsnHsGttmg..GHY source prosite : PS00973

Display surface Download Links