eF-site ID 3nec-A PDB Code 3nec Chain A click to enlarge Title Crystal Structure of Toxoplasma gondii Profilin Classification ACTIN-BINDING PROTEIN Compound Inflammatory profilin Source Toxoplasma gondii (Q58NA1_TOXGO) Sequence A:  SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDG WSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGS APNGVWIGGQKYKVVRPEKGFEYNDCTFDITXCARSKGGA HLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQS GY Description Functional site 1) chain A residue 3 type sequence D description BINDING SITE FOR RESIDUE DTV A 164 source : AC1 2) chain A residue 157 type sequence Y description BINDING SITE FOR RESIDUE DTV A 164 source : AC1 3) chain A residue 158 type sequence L description BINDING SITE FOR RESIDUE DTV A 164 source : AC1 4) chain A residue 161 type sequence S description BINDING SITE FOR RESIDUE DTV A 164 source : AC1 5) chain A residue 2 type sequence S description BINDING SITE FOR RESIDUE SO4 A 165 source : AC2 6) chain A residue 4 type sequence W description BINDING SITE FOR RESIDUE SO4 A 165 source : AC2 7) chain A residue 163 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 165 source : AC2 8) chain A residue 57 type sequence E description BINDING SITE FOR RESIDUE DTV B 164 source : AC3

Display surface Download Links