eF-site ID 3ncm_12-A
PDB Code 3ncm
Model 12
Chain A

click to enlarge
Title NEURAL CELL ADHESION MOLECULE, MODULE 2, NMR, 20 STRUCTURES
Classification CELL ADHESION PROTEIN
Compound PROTEIN (NEURAL CELL ADHESION MOLECULE, LARGE ISOFORM)
Source (NCA12_MOUSE)
Sequence A:  YVMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGR
DVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILAR
GEINFKDIQVIV
Description (1)  PROTEIN (NEURAL CELL ADHESION MOLECULE, LARGE ISOFORM) MUTANT (K1Y, L2V)

Display surface

Download
Links