eF-site ID 3n38-A PDB Code 3n38 Chain A click to enlarge Title Ribonucleotide Reductase NrdF from Escherichia coli Soaked with Ferrous Ions Classification OXIDOREDUCTASE Compound Ribonucleoside-diphosphate reductase 2 subunit beta Source null (RIR4_ECOLI) Sequence A:  ISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAW QTLTVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTP HEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWS EENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSG FWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQK NMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAETP WADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAA LS Description Functional site 1) chain A residue 67 type sequence D description BINDING SITE FOR RESIDUE FE2 A 320 source : AC1 2) chain A residue 98 type sequence E description BINDING SITE FOR RESIDUE FE2 A 320 source : AC1 3) chain A residue 101 type sequence H description BINDING SITE FOR RESIDUE FE2 A 320 source : AC1 4) chain A residue 192 type sequence E description BINDING SITE FOR RESIDUE FE2 A 320 source : AC1 5) chain A residue 98 type sequence E description BINDING SITE FOR RESIDUE FE2 A 321 source : AC2 6) chain A residue 158 type sequence E description BINDING SITE FOR RESIDUE FE2 A 321 source : AC2 7) chain A residue 192 type sequence E description BINDING SITE FOR RESIDUE FE2 A 321 source : AC2 8) chain A residue 195 type sequence H description BINDING SITE FOR RESIDUE FE2 A 321 source : AC2 9) chain A residue 192 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI4 10) chain A residue 195 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI4 11) chain A residue 105 type ACT_SITE sequence Y description ACT_SITE => ECO:0000255|PROSITE-ProRule:PRU10014 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 67 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU10014 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 101 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU10014 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 98 type BINDING sequence E description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 15) chain A residue 158 type BINDING sequence E description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 16) chain A residue 97-113 type prosite sequence MEAVHARSYSSIFSTLC description RIBORED_SMALL Ribonucleotide reductase small subunit signature. MEa.VHArSYssIfstLC source prosite : PS00368

Display surface Download Links