eF-site ID 3myi-A
PDB Code 3myi
Chain A

click to enlarge
Title Human metavinculin tail domain
Classification CELL ADHESION
Compound Vinculin
Source Homo sapiens (Human) (VINC_HUMAN)
Sequence A:  PVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAE
MSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQC
TDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNIS
DEESEQATEMLVHNAQNLMQSVKETVREAEAASIKITLRW
VRK
Description (1)  Vinculin

Display surface

Download
Links