eF-site ID 3mtn-A PDB Code 3mtn Chain A click to enlarge Title Usp21 in complex with a ubiquitin-based, USP21-specific inhibitor Classification HYDROLASE Compound Ubiquitin carboxyl-terminal hydrolase 21 Source Homo sapiens (Human) (P62988) Sequence A:  GHVGLRNLGNTCFLNAVLQCLSSTRPLRDFCLRRDFRQEV PGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQK YVPSFSGYSQQDAQEFLKLLMERLHLEINRRLSDDDRANL MWKRYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVF CDLSLPIPKKGFAGGKVSLRDCFNLFTKEEELESENAPVC DRCRQKTRSTKKLTVQRFPRILVLHLNRFSARGSIKKSSV GVDFPLQRLSLGDFASSPVYQLYALCNHSGSVHYGHYTAL CRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLM Description Functional site 1) chain A residue 384 type sequence C description BINDING SITE FOR RESIDUE ZN A 700 source : AC1 2) chain A residue 387 type sequence C description BINDING SITE FOR RESIDUE ZN A 700 source : AC1 3) chain A residue 437 type sequence C description BINDING SITE FOR RESIDUE ZN A 700 source : AC1 4) chain A residue 440 type sequence C description BINDING SITE FOR RESIDUE ZN A 700 source : AC1 5) chain A residue 401 type sequence S description BINDING SITE FOR RESIDUE CL A 1 source : AC3 6) chain A residue 360 type sequence K description BINDING SITE FOR RESIDUE CL A 563 source : AC5 7) chain A residue 454 type sequence R description BINDING SITE FOR RESIDUE CL A 563 source : AC5 8) chain A residue 311 type sequence E description BINDING SITE FOR RESIDUE GOL A 2 source : AC6 9) chain A residue 314 type sequence H description BINDING SITE FOR RESIDUE GOL A 2 source : AC6 10) chain A residue 370 type sequence I description BINDING SITE FOR RESIDUE GOL A 2 source : AC6 11) chain A residue 417 type sequence R description BINDING SITE FOR RESIDUE CL A 564 source : AC8 12) chain A residue 437 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 440 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 213-228 type prosite sequence GLRNLGNTCFLNAVLQ description USP_1 Ubiquitin specific protease (USP) domain signature 1. GLrnlGNtCFLNAvLQ source prosite : PS00972 15) chain A residue 502-519 type prosite sequence YQLYALCNHSGSVHYGHY description USP_2 Ubiquitin specific protease (USP) domain signature 2. YqLyALcnHsGsvhy..GHY source prosite : PS00973

Display surface Download Links