eF-site ID 3msf-A PDB Code 3msf Chain A click to enlarge Title Crystal structure of Thermolysin in complex with Urea Classification HYDROLASE Compound Thermolysin Source ORGANISM_SCIENTIFIC: Bacillus thermoproteolyticus; Sequence A:  ITGTSTVGVGRGVLGDQKNINTTYSTYYYLQDNTRGNGIF TYDAKYRTTLPGSLWADADNQFFASYDAPAVDAHYYAGVT YDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQM VYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNE SGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGD SLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKA AYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSN FSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGVK Description Functional site 1) chain A residue 142 type sequence H description BINDING SITE FOR RESIDUE ZN A 401 source : AC1 2) chain A residue 146 type sequence H description BINDING SITE FOR RESIDUE ZN A 401 source : AC1 3) chain A residue 166 type sequence E description BINDING SITE FOR RESIDUE ZN A 401 source : AC1 4) chain A residue 138 type sequence D description BINDING SITE FOR RESIDUE CA A 501 source : AC2 5) chain A residue 177 type sequence E description BINDING SITE FOR RESIDUE CA A 501 source : AC2 6) chain A residue 185 type sequence D description BINDING SITE FOR RESIDUE CA A 501 source : AC2 7) chain A residue 187 type sequence E description BINDING SITE FOR RESIDUE CA A 501 source : AC2 8) chain A residue 190 type sequence E description BINDING SITE FOR RESIDUE CA A 501 source : AC2 9) chain A residue 177 type sequence E description BINDING SITE FOR RESIDUE CA A 502 source : AC3 10) chain A residue 183 type sequence N description BINDING SITE FOR RESIDUE CA A 502 source : AC3 11) chain A residue 185 type sequence D description BINDING SITE FOR RESIDUE CA A 502 source : AC3 12) chain A residue 190 type sequence E description BINDING SITE FOR RESIDUE CA A 502 source : AC3 13) chain A residue 57 type sequence D description BINDING SITE FOR RESIDUE CA A 503 source : AC4 14) chain A residue 59 type sequence D description BINDING SITE FOR RESIDUE CA A 503 source : AC4 15) chain A residue 61 type sequence Q description BINDING SITE FOR RESIDUE CA A 503 source : AC4 16) chain A residue 193 type sequence Y description BINDING SITE FOR RESIDUE CA A 504 source : AC5 17) chain A residue 194 type sequence T description BINDING SITE FOR RESIDUE CA A 504 source : AC5 18) chain A residue 197 type sequence I description BINDING SITE FOR RESIDUE CA A 504 source : AC5 19) chain A residue 200 type sequence D description BINDING SITE FOR RESIDUE CA A 504 source : AC5 20) chain A residue 112 type sequence N description BINDING SITE FOR RESIDUE URE A 601 source : AC6 21) chain A residue 143 type sequence E description BINDING SITE FOR RESIDUE URE A 601 source : AC6 22) chain A residue 203 type sequence R description BINDING SITE FOR RESIDUE URE A 601 source : AC6 23) chain A residue 4 type sequence T description BINDING SITE FOR RESIDUE GOL A 801 source : AC7 24) chain A residue 5 type sequence S description BINDING SITE FOR RESIDUE GOL A 801 source : AC7 25) chain A residue 7 type sequence V description BINDING SITE FOR RESIDUE GOL A 801 source : AC7 26) chain A residue 28 type sequence Y description BINDING SITE FOR RESIDUE GOL A 801 source : AC7 27) chain A residue 60 type sequence N description BINDING SITE FOR RESIDUE GOL A 801 source : AC7 28) chain A residue 248 type sequence G description BINDING SITE FOR RESIDUE GOL A 802 source : AC8 29) chain A residue 254 type sequence S description BINDING SITE FOR RESIDUE GOL A 802 source : AC8 30) chain A residue 255 type sequence V description BINDING SITE FOR RESIDUE GOL A 802 source : AC8 31) chain A residue 256 type sequence V description BINDING SITE FOR RESIDUE GOL A 802 source : AC8 32) chain A residue 273 type sequence Q description BINDING SITE FOR RESIDUE GOL A 802 source : AC8 33) chain A residue 275 type sequence L description BINDING SITE FOR RESIDUE GOL A 802 source : AC8 34) chain A residue 146 type sequence H description BINDING SITE FOR RESIDUE GOL A 803 source : AC9 35) chain A residue 150 type sequence D description BINDING SITE FOR RESIDUE GOL A 803 source : AC9 36) chain A residue 157 type sequence Y description BINDING SITE FOR RESIDUE GOL A 803 source : AC9 37) chain A residue 165 type sequence N description BINDING SITE FOR RESIDUE GOL A 803 source : AC9 38) chain A residue 142 type catalytic sequence H description 176 source MCSA : MCSA1 39) chain A residue 143 type catalytic sequence E description 176 source MCSA : MCSA1 40) chain A residue 146 type catalytic sequence H description 176 source MCSA : MCSA1 41) chain A residue 157 type catalytic sequence Y description 176 source MCSA : MCSA1 42) chain A residue 166 type catalytic sequence E description 176 source MCSA : MCSA1 43) chain A residue 226 type catalytic sequence D description 176 source MCSA : MCSA1 44) chain A residue 231 type catalytic sequence H description 176 source MCSA : MCSA1 45) chain A residue 139-148 type prosite sequence VVAHELTHAV description ZINC_PROTEASE Neutral zinc metallopeptidases, zinc-binding region signature. VVAHELTHAV source prosite : PS00142 46) chain A residue 143 type ACT_SITE sequence E description ACT_SITE => ECO:0000255|PROSITE-ProRule:PRU10095, ECO:0000269|PubMed:4808703 source Swiss-Prot : SWS_FT_FI1 47) chain A residue 231 type ACT_SITE sequence H description Proton donor => ECO:0000255|PROSITE-ProRule:PRU10095, ECO:0000269|PubMed:4808703 source Swiss-Prot : SWS_FT_FI2 48) chain A residue 57 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3 49) chain A residue 185 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3 50) chain A residue 187 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 51) chain A residue 190 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 52) chain A residue 193 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 53) chain A residue 194 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI3 54) chain A residue 197 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI3 55) chain A residue 200 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3 56) chain A residue 59 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3 57) chain A residue 61 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI3 58) chain A residue 138 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3 59) chain A residue 142 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI3 60) chain A residue 146 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI3 61) chain A residue 166 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 62) chain A residue 177 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 63) chain A residue 183 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links