eF-site ID 3mp2-A PDB Code 3mp2 Chain A click to enlarge Title Crystal structure of transmissible gastroenteritis virus papain-like protease 1 Classification HYDROLASE Compound Non-structural protein 3 Source null (R1A_CVPPU) Sequence A:  SLPPFKTTNLNGKIILKQGDNNCWINACCYQLQAFDFFNN EAWEKFKKGDVMDFVNLCYAATTLARGHSGDAEYLLELML NDYSTAKIVLAAKCGCGEKEIVLERAVFKLTPLKESFNYG VCGDCMQVNTCRFLSVEGSGVFVHDILSKQTPEAMFVVKP VMHAVYTGTTQNGHYMVDDIEHGYCVDGMGIKPLKKRCYT STLFINANVMT Description Functional site 1) chain A residue 103 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 2) chain A residue 105 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 3) chain A residue 131 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 4) chain A residue 134 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 5) chain A residue 103-134 type ZN_FING sequence CGCGEKEIVLERAVFKLTPLKESFNYGVCGDC description C4-type 1; degenerate => ECO:0000255|PROSITE-ProRule:PRU00444 source Swiss-Prot : SWS_FT_FI1 6) chain A residue 196 type ACT_SITE sequence D description For PL1-PRO activity => ECO:0000255|PROSITE-ProRule:PRU00444 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 32 type ACT_SITE sequence C description For PL1-PRO activity => ECO:0000255|PROSITE-ProRule:PRU00444 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 183 type ACT_SITE sequence H description For PL1-PRO activity => ECO:0000255|PROSITE-ProRule:PRU00444 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links