eF-site ID 3mhs-A PDB Code 3mhs Chain A click to enlarge Title Structure of the SAGA Ubp8/Sgf11/Sus1/Sgf73 DUB module bound to ubiquitin aldehyde Classification Hydrolase/transcription regulator/protein binding Compound Ubiquitin carboxyl-terminal hydrolase 8 Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (SGF73_YEAST) Sequence A:  AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEK FLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSK QIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWD DVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNP YFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALN TSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIIN QIHQSYVLDLPNNNKQCECIVHTVFEGSLESSIVCPGCQN NSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNY HCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNR KLDDFIEFPTYLNMKNYCSTKEKDKENGKVPDIIYELIGI VSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVL KEQAYLLFYTIRQVN Description (1)  Ubiquitin carboxyl-terminal hydrolase 8 (E.C.3.1.2.15), Protein SUS1, SAGA-associated factor 11, SAGA-associated factor 73, ubiquitin Functional site 1) chain A residue 236 type sequence Q description BINDING SITE FOR RESIDUE EDO A 1295 source : AC1 2) chain A residue 240 type sequence E description BINDING SITE FOR RESIDUE EDO A 1295 source : AC1 3) chain A residue 367 type sequence H description BINDING SITE FOR RESIDUE GOL A 1487 source : AC2 4) chain A residue 369 type sequence L description BINDING SITE FOR RESIDUE GOL A 1487 source : AC2 5) chain A residue 371 type sequence G description BINDING SITE FOR RESIDUE GOL A 1487 source : AC2 6) chain A residue 4 type sequence C description BINDING SITE FOR RESIDUE ZN A 472 source : AC3 7) chain A residue 6 type sequence H description BINDING SITE FOR RESIDUE ZN A 472 source : AC3 8) chain A residue 96 type sequence C description BINDING SITE FOR RESIDUE ZN A 472 source : AC3 9) chain A residue 99 type sequence C description BINDING SITE FOR RESIDUE ZN A 472 source : AC3 10) chain A residue 46 type sequence C description BINDING SITE FOR RESIDUE ZN A 473 source : AC4 11) chain A residue 49 type sequence C description BINDING SITE FOR RESIDUE ZN A 473 source : AC4 12) chain A residue 68 type sequence C description BINDING SITE FOR RESIDUE ZN A 473 source : AC4 13) chain A residue 73 type sequence H description BINDING SITE FOR RESIDUE ZN A 473 source : AC4 14) chain A residue 60 type sequence C description BINDING SITE FOR RESIDUE ZN A 474 source : AC5 15) chain A residue 63 type sequence C description BINDING SITE FOR RESIDUE ZN A 474 source : AC5 16) chain A residue 77 type sequence H description BINDING SITE FOR RESIDUE ZN A 474 source : AC5 17) chain A residue 83 type sequence H description BINDING SITE FOR RESIDUE ZN A 474 source : AC5 18) chain A residue 170 type sequence H description BINDING SITE FOR RESIDUE ZN A 475 source : AC6 19) chain A residue 174 type sequence C description BINDING SITE FOR RESIDUE ZN A 475 source : AC6 20) chain A residue 182 type sequence C description BINDING SITE FOR RESIDUE ZN A 475 source : AC6 21) chain A residue 185 type sequence C description BINDING SITE FOR RESIDUE ZN A 475 source : AC6 22) chain A residue 250 type sequence H description BINDING SITE FOR RESIDUE ZN A 476 source : AC7 23) chain A residue 271 type sequence C description BINDING SITE FOR RESIDUE ZN A 476 source : AC7 24) chain A residue 273 type sequence C description BINDING SITE FOR RESIDUE ZN A 476 source : AC7 25) chain A residue 276 type sequence H description BINDING SITE FOR RESIDUE ZN A 476 source : AC7 26) chain A residue 289 type sequence C description BINDING SITE FOR RESIDUE ZN A 477 source : BC1 27) chain A residue 292 type sequence C description BINDING SITE FOR RESIDUE ZN A 477 source : BC1 28) chain A residue 336 type sequence C description BINDING SITE FOR RESIDUE ZN A 477 source : BC1 29) chain A residue 339 type sequence C description BINDING SITE FOR RESIDUE ZN A 477 source : BC1 30) chain A residue 138-153 type prosite sequence GLINMGSTCFMSSILQ description USP_1 Ubiquitin specific protease (USP) domain signature 1. GLinmGStCFMSSiLQ source prosite : PS00972 31) chain A residue 411-428 type prosite sequence YELIGIVSHKGTVNEGHY description USP_2 Ubiquitin specific protease (USP) domain signature 2. YeLiGIvsHkGtvne..GHY source prosite : PS00973 32) chain A residue 49 type MOD_RES sequence C description (Microbial infection) ADP-ribosylthreonine => ECO:0000269|PubMed:32330457 source Swiss-Prot : SWS_FT_FI4 33) chain A residue 60 type MOD_RES sequence C description (Microbial infection) ADP-ribosylthreonine => ECO:0000269|PubMed:32330457 source Swiss-Prot : SWS_FT_FI4 34) chain A residue 63 type MOD_RES sequence C description (Microbial infection) ADP-ribosylthreonine => ECO:0000269|PubMed:32330457 source Swiss-Prot : SWS_FT_FI4 35) chain A residue 68 type MOD_RES sequence C description (Microbial infection) ADP-ribosylthreonine => ECO:0000269|PubMed:32330457 source Swiss-Prot : SWS_FT_FI4 36) chain A residue 73 type MOD_RES sequence H description (Microbial infection) ADP-ribosylthreonine => ECO:0000269|PubMed:32330457 source Swiss-Prot : SWS_FT_FI4 37) chain A residue 77 type MOD_RES sequence H description (Microbial infection) ADP-ribosylthreonine => ECO:0000269|PubMed:32330457 source Swiss-Prot : SWS_FT_FI4 38) chain A residue 83 type MOD_RES sequence H description (Microbial infection) ADP-ribosylthreonine => ECO:0000269|PubMed:32330457 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links