eF-site ID 3mg0-V PDB Code 3mg0 Chain V click to enlarge Title Structure of yeast 20S proteasome with bortezomib Classification HYDROLASE Compound Proteasome component Y7 Source ORGANISM_COMMON: brewer's yeast,lager beer yeast,yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; Sequence V:  TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPK IWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSAL QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQ KSYKFPRGTTAVLKESIVNICD Description Functional site 1) chain V residue 1 type sequence T description BINDING SITE FOR RESIDUE BO2 V 1401 source : AC4 2) chain V residue 20 type sequence S description BINDING SITE FOR RESIDUE BO2 V 1401 source : AC4 3) chain V residue 21 type sequence T description BINDING SITE FOR RESIDUE BO2 V 1401 source : AC4 4) chain V residue 22 type sequence Q description BINDING SITE FOR RESIDUE BO2 V 1401 source : AC4 5) chain V residue 46 type sequence A description BINDING SITE FOR RESIDUE BO2 V 1401 source : AC4 6) chain V residue 47 type sequence G description BINDING SITE FOR RESIDUE BO2 V 1401 source : AC4 7) chain V residue 49 type sequence A description BINDING SITE FOR RESIDUE BO2 V 1401 source : AC4 8) chain V residue 114 type sequence H description BINDING SITE FOR RESIDUE BO2 2 1405 source : AC6 9) chain V residue 118 type sequence S description BINDING SITE FOR RESIDUE BO2 2 1405 source : AC6 10) chain V residue 1 type catalytic sequence T description 177 source MCSA : MCSA2 11) chain V residue 17 type catalytic sequence D description 177 source MCSA : MCSA2 12) chain V residue 19 type catalytic sequence R description 177 source MCSA : MCSA2 13) chain V residue 33 type catalytic sequence K description 177 source MCSA : MCSA2 14) chain V residue 47 type catalytic sequence G description 177 source MCSA : MCSA2 15) chain V residue 129 type catalytic sequence S description 177 source MCSA : MCSA2 16) chain V residue 166 type catalytic sequence D description 177 source MCSA : MCSA2 17) chain V residue 169 type catalytic sequence S description 177 source MCSA : MCSA2

Display surface Download Links