eF-site ID 3mey-A PDB Code 3mey Chain A click to enlarge Title Crystal structure of class II aaRS homologue (Bll0957) complexed with ATP Classification LIGASE Compound Bll0957 protein Source Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) (Q89VT8_BRAJA) Sequence A:  DPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSH REAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHG TEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPI AASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREY VCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPF FGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYH REHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGT DLSAWPAKVRDILGLQ Description (1)  Bll0957 protein Functional site 1) chain A residue 131 type sequence C description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 2) chain A residue 176 type sequence E description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 3) chain A residue 279 type sequence C description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 4) chain A residue 88 type sequence L description BINDING SITE FOR RESIDUE MG A 1001 source : AC2 5) chain A residue 159 type sequence R description BINDING SITE FOR RESIDUE MG A 1001 source : AC2 6) chain A residue 216 type sequence P description BINDING SITE FOR RESIDUE MG A 1001 source : AC2 7) chain A residue 159 type sequence R description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 8) chain A residue 161 type sequence E description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 9) chain A residue 167 type sequence D description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 10) chain A residue 168 type sequence R description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 11) chain A residue 169 type sequence L description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 12) chain A residue 172 type sequence F description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 13) chain A residue 174 type sequence M description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 14) chain A residue 216 type sequence P description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 15) chain A residue 235 type sequence K description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 16) chain A residue 237 type sequence E description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 17) chain A residue 250 type sequence A description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 18) chain A residue 251 type sequence C description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 19) chain A residue 253 type sequence S description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 20) chain A residue 281 type sequence A description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 21) chain A residue 283 type sequence G description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 22) chain A residue 286 type sequence R description BINDING SITE FOR RESIDUE ATP A 1010 source : AC3 23) chain A residue 131 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 24) chain A residue 159 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 25) chain A residue 161 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 26) chain A residue 168 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 27) chain A residue 176 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 28) chain A residue 235 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 29) chain A residue 250 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 30) chain A residue 279 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 31) chain A residue 286 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links