eF-site ID 3lxx-A PDB Code 3lxx Chain A click to enlarge Title Crystal structure of human GTPase IMAP family member 4 Classification IMMUNE SYSTEM Compound GTPase IMAP family member 4 Source Homo sapiens (Human) (GIMA4_HUMAN) Sequence A:  SQLRIVLVGKTGAGKSATGNSILGRKVFHSTKKCEKRSSS WKETELVVVDTPGIFNAETSKEIIRCILLTSPGPHALLLV VPLGRYTEEEHKATEKILKXFGERARSFXILIFTRKDDLP EDIQDLXDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRV VRENKEGCY Description (1)  GTPase IMAP family member 4 Functional site 1) chain A residue 39 type sequence T description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 2) chain A residue 40 type sequence G description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 3) chain A residue 41 type sequence A description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 4) chain A residue 42 type sequence G description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 5) chain A residue 43 type sequence K description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 6) chain A residue 44 type sequence S description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 7) chain A residue 45 type sequence A description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 8) chain A residue 58 type sequence S description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 9) chain A residue 155 type sequence R description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 10) chain A residue 157 type sequence D description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 11) chain A residue 189 type sequence L description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 12) chain A residue 190 type sequence N description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 13) chain A residue 191 type sequence N description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 14) chain A residue 192 type sequence K description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 15) chain A residue 44 type sequence S description BINDING SITE FOR RESIDUE MG A 402 source : AC2 16) chain A residue 66 type sequence T description BINDING SITE FOR RESIDUE MG A 402 source : AC2 17) chain A residue 37 type BINDING sequence G description BINDING => ECO:0000269|Ref.8, ECO:0007744|PDB:3LXX source Swiss-Prot : SWS_FT_FI1 18) chain A residue 58 type BINDING sequence S description BINDING => ECO:0000269|Ref.8, ECO:0007744|PDB:3LXX source Swiss-Prot : SWS_FT_FI1 19) chain A residue 155 type BINDING sequence R description BINDING => ECO:0000269|Ref.8, ECO:0007744|PDB:3LXX source Swiss-Prot : SWS_FT_FI1 20) chain A residue 191 type BINDING sequence N description BINDING => ECO:0000269|Ref.8, ECO:0007744|PDB:3LXX source Swiss-Prot : SWS_FT_FI1

Display surface Download Links