eF-site ID 3lja-H PDB Code 3lja Chain H click to enlarge Title Using Soft X-Rays for a Detailed Picture of Divalent Metal Binding in the Nucleosome Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.2 Source Xenopus laevis (African clawed frog) (3LJA) Sequence H:  KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFV NDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL AKHAVSEGTKAVTKYTSAK Description Functional site 1) chain H residue 45 type sequence V description BINDING SITE FOR RESIDUE MN H 123 source : BC9 2) chain H residue 87 type sequence T description BINDING SITE FOR RESIDUE SO4 G 3145 source : CC9 3) chain H residue 88 type sequence S description BINDING SITE FOR RESIDUE SO4 G 3145 source : CC9 4) chain H residue 46 type sequence H description BINDING SITE FOR RESIDUE SO4 H 3147 source : DC2 5) chain H residue 47 type sequence P description BINDING SITE FOR RESIDUE SO4 H 3147 source : DC2 6) chain H residue 48 type sequence D description BINDING SITE FOR RESIDUE SO4 H 3147 source : DC2 7) chain H residue 49 type sequence T description BINDING SITE FOR RESIDUE SO4 H 3147 source : DC2 8) chain H residue 117 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine; alternate => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links