eF-site ID 3lgl-A PDB Code 3lgl Chain A click to enlarge Title Crystal structure of the 53BP1 tandem tudor domain in complex with p53K382me2 Classification CELL CYCLE Compound Tumor suppressor p53-binding protein 1 Source null (3LGL) Sequence A:  SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYE CDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKE SGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG Description Functional site 1) chain A residue 1514 type sequence K description BINDING SITE FOR RESIDUE PGE A 201 source : AC1 2) chain A residue 1564 type sequence E description BINDING SITE FOR RESIDUE PGE A 201 source : AC1 3) chain A residue 1580 type sequence W description BINDING SITE FOR RESIDUE PGE A 201 source : AC1 4) chain A residue 1490 type sequence R description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 5) chain A residue 1567 type sequence E description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 6) chain A residue 1568 type sequence L description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 7) chain A residue 1583 type sequence R description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 8) chain A residue 1563 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:25114211, ECO:0007744|PubMed:25218447, ECO:0007744|PubMed:25755297, ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links