eF-site ID 3ldd-A PDB Code 3ldd Chain A click to enlarge Title High resolution open MthK pore structure crystallized in 100 mM K+ and further soaked in 99 mM Na+/1 mM K+. Classification TRANSPORT PROTEIN Compound Calcium-gated potassium channel mthK Source null (MTHK_METTH) Sequence A:  VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTI ATVGYGDYSPRTPLGMYFTCTLIVLGIGTFAVAVERLLEF LI Description Functional site 1) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE K A 1 source : AC1 2) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE K A 1 source : AC1 3) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE K A 1 source : AC1 4) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE K A 1 source : AC1 5) chain A residue 62 type sequence Y description BINDING SITE FOR RESIDUE K A 1 source : AC1 6) chain A residue 62 type sequence Y description BINDING SITE FOR RESIDUE K A 1 source : AC1 7) chain A residue 62 type sequence Y description BINDING SITE FOR RESIDUE K A 1 source : AC1 8) chain A residue 62 type sequence Y description BINDING SITE FOR RESIDUE K A 1 source : AC1 9) chain A residue 60 type sequence V description BINDING SITE FOR RESIDUE K A 2 source : AC2 10) chain A residue 60 type sequence V description BINDING SITE FOR RESIDUE K A 2 source : AC2 11) chain A residue 60 type sequence V description BINDING SITE FOR RESIDUE K A 2 source : AC2 12) chain A residue 60 type sequence V description BINDING SITE FOR RESIDUE K A 2 source : AC2 13) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE K A 2 source : AC2 14) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE K A 2 source : AC2 15) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE K A 2 source : AC2 16) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE K A 2 source : AC2 17) chain A residue 59 type sequence T description BINDING SITE FOR RESIDUE K A 3 source : AC3 18) chain A residue 59 type sequence T description BINDING SITE FOR RESIDUE K A 3 source : AC3 19) chain A residue 59 type sequence T description BINDING SITE FOR RESIDUE K A 3 source : AC3 20) chain A residue 59 type sequence T description BINDING SITE FOR RESIDUE K A 3 source : AC3 21) chain A residue 60 type sequence V description BINDING SITE FOR RESIDUE K A 3 source : AC3 22) chain A residue 60 type sequence V description BINDING SITE FOR RESIDUE K A 3 source : AC3 23) chain A residue 60 type sequence V description BINDING SITE FOR RESIDUE K A 3 source : AC3 24) chain A residue 60 type sequence V description BINDING SITE FOR RESIDUE K A 3 source : AC3 25) chain A residue 59 type sequence T description BINDING SITE FOR RESIDUE K A 4 source : AC4 26) chain A residue 59 type sequence T description BINDING SITE FOR RESIDUE K A 4 source : AC4 27) chain A residue 59 type sequence T description BINDING SITE FOR RESIDUE K A 4 source : AC4 28) chain A residue 59 type sequence T description BINDING SITE FOR RESIDUE K A 4 source : AC4 29) chain A residue 49-58 type INTRAMEM sequence SLYWTFVTIA description Helical; Pore-forming => ECO:0000255 source Swiss-Prot : SWS_FT_FI3 30) chain A residue 59-64 type INTRAMEM sequence TVGYGD description Pore-forming => ECO:0000255 source Swiss-Prot : SWS_FT_FI4 31) chain A residue 70-95 type TRANSMEM sequence PLGMYFTCTLIVLGIGTFAVAVERLL description Helical; Name=Inner helix M2 source Swiss-Prot : SWS_FT_FI5 32) chain A residue 21-41 type TRANSMEM sequence TRILLLVLAVIIYGTAGFHFI description Helical; Name=Outer helix M1 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 42-48 type TOPO_DOM sequence EGESWTV description Extracellular source Swiss-Prot : SWS_FT_FI2 34) chain A residue 65-69 type TOPO_DOM sequence YSPRT description Extracellular source Swiss-Prot : SWS_FT_FI2

Display surface Download Links