eF-site ID 3laj-E PDB Code 3laj Chain E click to enlarge Title The Structure of the Intermediate Complex of the Arginine Repressor from Mycobacterium tuberculosis Bound to its DNA Operator and L-arginine. Classification TRANSCRIPTION REGULATOR Compound Arginine repressor Source Mycobacterium tuberculosis (3LAJ) Sequence E:  NRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATL SRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDR MARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAAL PQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR Description Functional site 1) chain E residue 146 type sequence D description BINDING SITE FOR RESIDUE ARG B 200 source : AC2 2) chain E residue 129 type sequence S description BINDING SITE FOR RESIDUE ARG E 200 source : AC5 3) chain E residue 132 type sequence D description BINDING SITE FOR RESIDUE ARG E 200 source : AC5 4) chain E residue 142 type sequence T description BINDING SITE FOR RESIDUE ARG E 200 source : AC5 5) chain E residue 144 type sequence A description BINDING SITE FOR RESIDUE ARG E 200 source : AC5 6) chain E residue 145 type sequence G description BINDING SITE FOR RESIDUE ARG F 200 source : AC6 7) chain E residue 146 type sequence D description BINDING SITE FOR RESIDUE ARG F 200 source : AC6 8) chain E residue 147 type sequence D description BINDING SITE FOR RESIDUE ARG F 200 source : AC6 9) chain E residue 148 type sequence T description BINDING SITE FOR RESIDUE ARG F 200 source : AC6

Display surface Download Links