eF-site ID 3l0e-A PDB Code 3l0e Chain A click to enlarge Title X-ray crystal structure of a Potent Liver X Receptor Modulator Classification TRANSCRIPTION Compound Oxysterols receptor LXR-beta Source Homo sapiens (Human) (NCOA2_HUMAN) Sequence A:  QLTAAQELMIQQLVAAQLQSNKRSFSDQPKVTPWPLGADP QSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGRE DQIALLKASTIEIMLLETARRYNHETESITFLKDFTYSKD DFHRAGLQVEFINPIFEFSRAMSSLGLDDAEYALLIAINI FSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRF PRMLMKLVSLRTLSSVHSEQVFALRLADAALPPLLSEIWD VHE Description Functional site 1) chain A residue 268 type sequence F description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 2) chain A residue 271 type sequence F description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 3) chain A residue 272 type sequence T description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 4) chain A residue 274 type sequence L description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 5) chain A residue 275 type sequence A description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 6) chain A residue 278 type sequence S description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 7) chain A residue 309 type sequence I description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 8) chain A residue 312 type sequence M description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 9) chain A residue 316 type sequence T description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 10) chain A residue 319 type sequence R description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 11) chain A residue 329 type sequence F description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 12) chain A residue 330 type sequence L description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 13) chain A residue 340 type sequence F description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 14) chain A residue 343 type sequence A description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 15) chain A residue 344 type sequence G description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 16) chain A residue 345 type sequence L description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 17) chain A residue 435 type sequence H description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 18) chain A residue 442 type sequence L description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 19) chain A residue 453 type sequence L description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 20) chain A residue 457 type sequence W description BINDING SITE FOR RESIDUE G58 A 1 source : AC1 21) chain A residue 409 type CROSSLNK sequence I description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0000269|PubMed:20159957 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 447 type CROSSLNK sequence A description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0000269|PubMed:20159957 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links