eF-site ID 3kyz-A PDB Code 3kyz Chain A click to enlarge Title The crystal structure of the sensor domain of two-component sensor PfeS from Pseudomonas aeruginosa PA01 Classification TRANSFERASE Compound Sensor protein pfeS Source Pseudomonas aeruginosa (PFES_PSEAE) Sequence A:  YFLAPADRHYLADYARQAEDAWRREGAAGAERFRKELSAK EDTWVALVGPHLESLGSTPLSAEESSHLTFXRKLDWPXSR RLQDELPYVSIEFPGHPEQGRLVIQLPERLLP Description (1)  Sensor protein pfeS (E.C.2.7.13.3) Functional site 1) chain A residue 128 type sequence E description BINDING SITE FOR RESIDUE CL A 1 source : AC1 2) chain A residue 85 type sequence G description BINDING SITE FOR RESIDUE CL A 2 source : AC2 3) chain A residue 86 type sequence P description BINDING SITE FOR RESIDUE CL A 2 source : AC2 4) chain A residue 87 type sequence H description BINDING SITE FOR RESIDUE CL A 2 source : AC2 5) chain A residue 89 type sequence E description BINDING SITE FOR RESIDUE CL A 2 source : AC2 6) chain A residue 89 type sequence E description BINDING SITE FOR RESIDUE CL A 3 source : AC3 7) chain A residue 90 type sequence S description BINDING SITE FOR RESIDUE CL A 3 source : AC3 8) chain A residue 95 type sequence P description BINDING SITE FOR RESIDUE CL A 3 source : AC3 9) chain A residue 96 type sequence L description BINDING SITE FOR RESIDUE CL A 3 source : AC3 10) chain A residue 53 type sequence Q description BINDING SITE FOR RESIDUE FMT A 150 source : AC4

Display surface Download Links