eF-site ID 3kxu-A PDB Code 3kxu Chain A click to enlarge Title Crystal structure of human ferritin FTL498InsTC pathogenic mutant Classification METAL BINDING PROTEIN Compound Ferritin Source Homo sapiens (Human) (Q6S4P3_HUMAN) Sequence A:  SSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRD DVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQD IKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSAR TDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGG Description Functional site 1) chain A residue 115 type sequence H description BINDING SITE FOR RESIDUE CD A 301 source : AC1 2) chain A residue 127 type sequence C description BINDING SITE FOR RESIDUE CD A 301 source : AC1 3) chain A residue 50 type sequence H description BINDING SITE FOR RESIDUE CD A 302 source : AC2 4) chain A residue 54 type sequence E description BINDING SITE FOR RESIDUE CD A 302 source : AC2 5) chain A residue 50 type sequence H description BINDING SITE FOR RESIDUE CD A 304 source : AC3 6) chain A residue 54 type sequence E description BINDING SITE FOR RESIDUE CD A 305 source : AC4 7) chain A residue 57 type sequence E description BINDING SITE FOR RESIDUE CD A 305 source : AC4 8) chain A residue 58 type sequence E description BINDING SITE FOR RESIDUE CD A 306 source : AC5 9) chain A residue 61 type sequence E description BINDING SITE FOR RESIDUE CD A 306 source : AC5 10) chain A residue 89 type sequence E description BINDING SITE FOR RESIDUE CD A 308 source : AC6 11) chain A residue 133 type sequence H description BINDING SITE FOR RESIDUE CD A 309 source : AC7 12) chain A residue 87 type sequence E description BINDING SITE FOR RESIDUE CD A 312 source : AC8 13) chain A residue 127 type sequence C description BINDING SITE FOR RESIDUE CD A 313 source : AC9 14) chain A residue 128 type sequence D description BINDING SITE FOR RESIDUE CD A 313 source : AC9 15) chain A residue 131 type sequence E description BINDING SITE FOR RESIDUE CD A 313 source : AC9 16) chain A residue 131 type sequence E description BINDING SITE FOR RESIDUE CD A 313 source : AC9 17) chain A residue 128 type sequence D description BINDING SITE FOR RESIDUE CD A 314 source : BC1 18) chain A residue 12 type sequence D description BINDING SITE FOR RESIDUE CD A 315 source : BC2 19) chain A residue 12 type sequence D description BINDING SITE FOR RESIDUE CD A 315 source : BC2 20) chain A residue 153 type sequence H description BINDING SITE FOR RESIDUE CD A 316 source : BC3 21) chain A residue 10 type sequence S description BINDING SITE FOR RESIDUE SO4 A 317 source : BC4 22) chain A residue 12 type sequence D description BINDING SITE FOR RESIDUE SO4 A 317 source : BC4 23) chain A residue 121 type sequence R description BINDING SITE FOR RESIDUE SO4 A 317 source : BC4 24) chain A residue 121 type sequence R description BINDING SITE FOR RESIDUE SO4 A 317 source : BC4 25) chain A residue 2 type MOD_RES sequence S description N-acetylserine => ECO:0000269|PubMed:6653779 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 54 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 27) chain A residue 57 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 28) chain A residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 29) chain A residue 61 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 30) chain A residue 64 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 31) chain A residue 123-143 type prosite sequence DPHLCDFLETHFLDEEVKLIK description FERRITIN_2 Ferritin iron-binding regions signature 2. DphLCDFLEthFLdeevklIK source prosite : PS00204 32) chain A residue 58-76 type prosite sequence EKREGYERLLKMQNQRGGR description FERRITIN_1 Ferritin iron-binding regions signature 1. EkREgyERLLkmQNqRgGR source prosite : PS00540

Display surface Download Links