eF-site ID 3kqi-A PDB Code 3kqi Chain A click to enlarge Title crystal structure of PHF2 PHD domain complexed with H3K4Me3 peptide Classification NUCLEAR PROTEIN Compound PHD finger protein 2 Source (H31_HUMAN) Sequence A:  GSMATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVE EEEAPDIDIYHCPNCEKTHGKSTLKKKRTWH Description (1)  PHD finger protein 2 Functional site 1) chain A residue 23 type sequence C description BINDING SITE FOR RESIDUE ZN A 71 source : AC1 2) chain A residue 26 type sequence C description BINDING SITE FOR RESIDUE ZN A 71 source : AC1 3) chain A residue 50 type sequence C description BINDING SITE FOR RESIDUE ZN A 71 source : AC1 4) chain A residue 53 type sequence C description BINDING SITE FOR RESIDUE ZN A 71 source : AC1 5) chain A residue 8 type sequence C description BINDING SITE FOR RESIDUE ZN A 72 source : AC2 6) chain A residue 10 type sequence C description BINDING SITE FOR RESIDUE ZN A 72 source : AC2 7) chain A residue 31 type sequence H description BINDING SITE FOR RESIDUE ZN A 72 source : AC2 8) chain A residue 34 type sequence C description BINDING SITE FOR RESIDUE ZN A 72 source : AC2 9) chain A residue 53 type sequence C description BINDING SITE FOR RESIDUE GOL A 968 source : AC3 10) chain A residue 56 type sequence T description BINDING SITE FOR RESIDUE GOL A 968 source : AC3 11) chain A residue 57 type sequence H description BINDING SITE FOR RESIDUE GOL A 968 source : AC3 12) chain A residue 57 type sequence H description BINDING SITE FOR RESIDUE GOL A 968 source : AC3 13) chain A residue 64 type sequence K description BINDING SITE FOR RESIDUE CL A 73 source : AC4 14) chain A residue 67 type sequence T description BINDING SITE FOR RESIDUE MG A 74 source : AC5 15) chain A residue 33 type sequence S description BINDING SITE FOR RESIDUE MG A 75 source : AC6 16) chain A residue 8-23 type prosite sequence CVCRLPYDVTRFMIEC description EGF_2 EGF-like domain signature 2. CvCrlPYdvtrfmieC source prosite : PS01186 17) chain A residue 8-53 type prosite sequence CVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDI YHCPNC description ZF_PHD_1 Zinc finger PHD-type signature. Cv.Crlpydvtrfm...................................IeCda..Ckdw.FHgsCvgveeeeapdidi................................YhCpnC source prosite : PS01359

Display surface Download Links