eF-site ID 3kq6-D PDB Code 3kq6 Chain D click to enlarge Title Enhancing the Therapeutic Properties of a Protein by a Designed Zinc-Binding Site, Structural principles of a novel long-acting insulin analog Classification HORMONE Compound Insulin A chain Source Homo sapiens (Human) (INS_HUMAN) Sequence D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT Description Functional site 1) chain D residue 4 type sequence Q description BINDING SITE FOR RESIDUE CL A 302 source : AC2 2) chain D residue 5 type sequence H description BINDING SITE FOR RESIDUE IPH C 100 source : AC4 3) chain D residue 11 type sequence L description BINDING SITE FOR RESIDUE IPH C 100 source : AC4 4) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC5 5) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC5 6) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC5 7) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC6 8) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC6 9) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC6

Display surface Download Links