eF-site ID 3kq6-ABCD PDB Code 3kq6 Chain A, B, C, D click to enlarge Title Enhancing the Therapeutic Properties of a Protein by a Designed Zinc-Binding Site, Structural principles of a novel long-acting insulin analog Classification HORMONE Compound Insulin A chain Source Homo sapiens (Human) (INS_HUMAN) Sequence A:  GIVHQCCHSICSLYQLENYCN B:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT C:  GIVHQCCHSICSLYQLENYCN D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT Description Functional site 1) chain A residue 4 type sequence H description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 2) chain A residue 8 type sequence H description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 3) chain C residue 4 type sequence H description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 4) chain A residue 4 type sequence H description BINDING SITE FOR RESIDUE CL A 302 source : AC2 5) chain A residue 8 type sequence H description BINDING SITE FOR RESIDUE CL A 302 source : AC2 6) chain C residue 3 type sequence V description BINDING SITE FOR RESIDUE CL A 302 source : AC2 7) chain D residue 4 type sequence Q description BINDING SITE FOR RESIDUE CL A 302 source : AC2 8) chain B residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN B 101 source : AC3 9) chain B residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN B 101 source : AC3 10) chain B residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN B 101 source : AC3 11) chain C residue 6 type sequence C description BINDING SITE FOR RESIDUE IPH C 100 source : AC4 12) chain C residue 9 type sequence S description BINDING SITE FOR RESIDUE IPH C 100 source : AC4 13) chain C residue 10 type sequence I description BINDING SITE FOR RESIDUE IPH C 100 source : AC4 14) chain C residue 11 type sequence C description BINDING SITE FOR RESIDUE IPH C 100 source : AC4 15) chain D residue 5 type sequence H description BINDING SITE FOR RESIDUE IPH C 100 source : AC4 16) chain D residue 11 type sequence L description BINDING SITE FOR RESIDUE IPH C 100 source : AC4 17) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC5 18) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC5 19) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC5 20) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC6 21) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC6 22) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC6 23) chain A residue 6-20 type prosite sequence CCHSICSLYQLENYC description INSULIN Insulin family signature. CCHSiCSlyqLenyC source prosite : PS00262

Display surface Download Links