eF-site ID 3kky-A
PDB Code 3kky
Chain A

click to enlarge
Title Structure of Manganese Superoxide Dismutase from Deinococcus Radiodurans in the orthorhombic space group P212121: A case study of mistaken identity
Classification METAL BINDING PROTEIN
Compound Superoxide dismutase [Mn]
Source Deinococcus radiodurans (SODM_DEIRA)
Sequence A:  AYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANK
ALEGTEFADLPVEQLIQQLDRVPADKKGALRNNAGGHANH
SMFWQIMGQANQPSGELLDAINSAFGSFDAFKQKFEDAAK
TRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGT
PILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRY
AAAK
Description (1)  Superoxide dismutase [Mn] (E.C.1.15.1.1)


Functional site

1) chain A
residue 26
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 211
source : AC1

2) chain A
residue 80
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 211
source : AC1

3) chain A
residue 172
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 211
source : AC1

4) chain A
residue 176
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 211
source : AC1

5) chain A
residue 27
type METAL
ligand
sequence H
description Manganese (By similarity)
source Swiss-Prot : SWS_FT_FI1

6) chain A
residue 81
type METAL
ligand
sequence S
description Manganese (By similarity)
source Swiss-Prot : SWS_FT_FI1

7) chain A
residue 173
type METAL
ligand
sequence V
description Manganese (By similarity)
source Swiss-Prot : SWS_FT_FI1

8) chain A
residue 177
type METAL
ligand
sequence A
description Manganese (By similarity)
source Swiss-Prot : SWS_FT_FI1

9) chain A
residue 172-179
type prosite
ligand
sequence DVWEHAYY
description Manganese and iron superoxide dismutases signature. D-x-[WF]-E-H-[STA]-[FY](2)
source prosite : PS00088


Display surface

Download
Links