eF-site ID 3kjy-B
PDB Code 3kjy
Chain B

click to enlarge
Title Crystal structure of reduced HOMO SAPIENS CLIC3
Classification TRANSPORT PROTEIN
Compound Chloride intracellular channel protein 3
Source Homo sapiens (Human) (CLIC3_HUMAN)
Sequence B:  LEVLFQGKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGV
PFTLTTVDGSQLPILLYDSDAKTDTLQIEDFLEETLGPPD
FPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQ
LLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLT
LADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM
QEKEFKYTCPHSAEILAAYR
Description (1)  Chloride intracellular channel protein 3


Functional site

1) chain B
residue 111
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 231
source : AC1

2) chain B
residue 130
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 A 231
source : AC1

3) chain B
residue 196
type
ligand
sequence P
description BINDING SITE FOR RESIDUE SO4 A 232
source : AC2

4) chain B
residue 197
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 A 232
source : AC2

5) chain B
residue 198
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 232
source : AC2

6) chain B
residue 27
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 233
source : AC3

7) chain B
residue 76
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SO4 A 233
source : AC3

8) chain B
residue 110
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 235
source : AC5

9) chain B
residue 110
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 B 231
source : AC6

10) chain B
residue 179
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 B 231
source : AC6

11) chain B
residue 133
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 232
source : AC7

12) chain B
residue 137
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 232
source : AC7

13) chain B
residue 44-64
type TRANSMEM
ligand
sequence VDGSQLPI
description Helical; (Potential).
source Swiss-Prot : SWS_FT_FI2

14) chain B
residue 10
type catalytic
ligand
sequence V
description Annotated By Reference To The Literature 1oe8
source CSA : CSA2


Display surface

Download
Links