eF-site ID 3kjy-AB
PDB Code 3kjy
Chain A, B

click to enlarge
Title Crystal structure of reduced HOMO SAPIENS CLIC3
Classification TRANSPORT PROTEIN
Compound Chloride intracellular channel protein 3
Source Homo sapiens (Human) (CLIC3_HUMAN)
Sequence A:  LEVLFQTKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGV
PFTLTTVDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLG
PPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEAL
YQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGD
RLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLD
SAMQEKEFKYTCPHSAEILAAYR
B:  LEVLFQGKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGV
PFTLTTVDGSQLPILLYDSDAKTDTLQIEDFLEETLGPPD
FPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQ
LLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLT
LADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM
QEKEFKYTCPHSAEILAAYR
Description (1)  Chloride intracellular channel protein 3


Functional site

1) chain A
residue 27
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 231
source : AC1

2) chain A
residue 76
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SO4 A 231
source : AC1

3) chain B
residue 111
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 231
source : AC1

4) chain B
residue 130
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 A 231
source : AC1

5) chain A
residue 221
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 232
source : AC2

6) chain A
residue 222
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 232
source : AC2

7) chain B
residue 196
type
ligand
sequence P
description BINDING SITE FOR RESIDUE SO4 A 232
source : AC2

8) chain B
residue 197
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 A 232
source : AC2

9) chain B
residue 198
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 232
source : AC2

10) chain A
residue 111
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 233
source : AC3

11) chain B
residue 27
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 233
source : AC3

12) chain B
residue 76
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SO4 A 233
source : AC3

13) chain A
residue 97
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 234
source : AC4

14) chain A
residue 148
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 234
source : AC4

15) chain A
residue 166
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 A 234
source : AC4

16) chain A
residue 167
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 A 234
source : AC4

17) chain A
residue 168
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 234
source : AC4

18) chain A
residue 109
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SO4 A 235
source : AC5

19) chain A
residue 110
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 235
source : AC5

20) chain A
residue 179
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 235
source : AC5

21) chain B
residue 110
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 235
source : AC5

22) chain A
residue 110
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 B 231
source : AC6

23) chain B
residue 110
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 B 231
source : AC6

24) chain B
residue 179
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 B 231
source : AC6

25) chain B
residue 133
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 232
source : AC7

26) chain B
residue 137
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 232
source : AC7

27) chain A
residue 44-64
type TRANSMEM
ligand
sequence VDFAPGSQLPI
description Helical; (Potential).
source Swiss-Prot : SWS_FT_FI1

28) chain B
residue 44-64
type TRANSMEM
ligand
sequence VDGSQLPI
description Helical; (Potential).
source Swiss-Prot : SWS_FT_FI2

29) chain A
residue 10
type catalytic
ligand
sequence V
description Annotated By Reference To The Literature 1oe8
source CSA : CSA1

30) chain B
residue 10
type catalytic
ligand
sequence V
description Annotated By Reference To The Literature 1oe8
source CSA : CSA2


Display surface

Download
Links