eF-site ID 3kjy-A
PDB Code 3kjy
Chain A

click to enlarge
Title Crystal structure of reduced HOMO SAPIENS CLIC3
Classification TRANSPORT PROTEIN
Compound Chloride intracellular channel protein 3
Source Homo sapiens (Human) (CLIC3_HUMAN)
Sequence A:  LEVLFQTKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGV
PFTLTTVDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLG
PPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEAL
YQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGD
RLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLD
SAMQEKEFKYTCPHSAEILAAYR
Description (1)  Chloride intracellular channel protein 3


Functional site

1) chain A
residue 27
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 231
source : AC1

2) chain A
residue 76
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SO4 A 231
source : AC1

3) chain A
residue 221
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 232
source : AC2

4) chain A
residue 222
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 232
source : AC2

5) chain A
residue 111
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 233
source : AC3

6) chain A
residue 97
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 234
source : AC4

7) chain A
residue 148
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 234
source : AC4

8) chain A
residue 166
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 A 234
source : AC4

9) chain A
residue 167
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 A 234
source : AC4

10) chain A
residue 168
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 234
source : AC4

11) chain A
residue 109
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SO4 A 235
source : AC5

12) chain A
residue 110
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 235
source : AC5

13) chain A
residue 179
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 235
source : AC5

14) chain A
residue 110
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 B 231
source : AC6

15) chain A
residue 44-64
type TRANSMEM
ligand
sequence VDFAPGSQLPI
description Helical; (Potential).
source Swiss-Prot : SWS_FT_FI1

16) chain A
residue 10
type catalytic
ligand
sequence V
description Annotated By Reference To The Literature 1oe8
source CSA : CSA1


Display surface

Download
Links