eF-site ID 3kj6-A PDB Code 3kj6 Chain A click to enlarge Title Crystal structure of a Methylated beta2 Adrenergic Receptor-Fab complex Classification SIGNALING PROTEIN Compound Beta-2 adrenergic receptor Source Homo sapiens (Human) (3KJ6) Sequence A:  GMGIVMSLIVLAIVFGNVLVITAIAFERLQTVTNYFITSL ACADLVMGLAVVPFGAFWTSIDVLCVTASIETLCVIAVDR YFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSSIVSFY VPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVKFCLKEH KALKTLGIIMGTFTLCWLPFFIVYILLNWIGYVNSGFNPL IYCRSPDFRIAFQELLCLRRSS Description Functional site 1) chain A residue 66 type sequence T description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 2) chain A residue 67 type sequence V description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 3) chain A residue 68 type sequence T description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 4) chain A residue 142 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 5) chain A residue 143 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 6) chain A residue 341 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000269|PubMed:17962520, ECO:0000269|PubMed:18547522, ECO:0000269|PubMed:2540197, ECO:0000269|PubMed:27481942 source Swiss-Prot : SWS_FT_FI18 7) chain A residue 345 type MOD_RES sequence S description Phosphoserine; by PKA => ECO:0000269|PubMed:11146000 source Swiss-Prot : SWS_FT_FI15 8) chain A residue 346 type MOD_RES sequence S description Phosphoserine; by PKA => ECO:0000269|PubMed:11146000 source Swiss-Prot : SWS_FT_FI15 9) chain A residue 265 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000269|PubMed:27481942 source Swiss-Prot : SWS_FT_FI17 10) chain A residue 35-58 type TRANSMEM sequence GMGIVMSLIVLAIVFGNVLVITAI description Helical; Name=1 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 59-71 type TOPO_DOM sequence AFERLQTVTNYF description Cytoplasmic source Swiss-Prot : SWS_FT_FI2 12) chain A residue 130-150 type TOPO_DOM sequence DRYFAITSPFKYQSLLTKNKA description Cytoplasmic source Swiss-Prot : SWS_FT_FI2 13) chain A residue 221-274 type TOPO_DOM sequence RVFQEAKRQLQKIDKSEGRFHVKFCLKEHKALKT description Cytoplasmic source Swiss-Prot : SWS_FT_FI2 14) chain A residue 141 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:8521811 source Swiss-Prot : SWS_FT_FI12 15) chain A residue 113 type BINDING sequence D description BINDING => ECO:0000269|PubMed:18547522, ECO:0007744|PDB:3D4S source Swiss-Prot : SWS_FT_FI10 16) chain A residue 118 type BINDING sequence T description BINDING => ECO:0000269|PubMed:18547522, ECO:0007744|PDB:3D4S source Swiss-Prot : SWS_FT_FI10 17) chain A residue 312 type BINDING sequence N description BINDING => ECO:0000269|PubMed:18547522, ECO:0007744|PDB:3D4S source Swiss-Prot : SWS_FT_FI10 18) chain A residue 316 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:18547522, ECO:0007744|PDB:3D4S source Swiss-Prot : SWS_FT_FI10 19) chain A residue 203 type BINDING sequence S description BINDING => ECO:0000269|PubMed:17952055, ECO:0000269|PubMed:17962520, ECO:0007744|PDB:2RH1 source Swiss-Prot : SWS_FT_FI11 20) chain A residue 119-135 type prosite sequence ASIETLCVIAVDRYFAI description G_PROTEIN_RECEP_F1_1 G-protein coupled receptors family 1 signature. ASIeTLCVIAVDRYFaI source prosite : PS00237

Display surface Download Links