eF-site ID 3kip-W PDB Code 3kip Chain W click to enlarge Title Crystal structure of type-II 3-dehydroquinase from C. albicans Classification LYASE Compound 3-dehydroquinase, type II Source Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) (Q59Z17_CANAL) Sequence W:  QLVKKVLLINGPNLNLLGTRYGTTSLSDIEQAAIEQAKLK NNDSEVLVFQSNTEGFIIDRIHEAKRQGVGFVVINAGAYT HTSVGIRDALLGTAIPFIEVHITNVHQREPFRHQSYLSDK AVAVICGLGVYGYTAAIEYALNYQL Description Functional site 1) chain W residue 77 type sequence N description BINDING SITE FOR RESIDUE SO4 W 155 source : CC3 2) chain W residue 103 type sequence H description BINDING SITE FOR RESIDUE SO4 W 155 source : CC3 3) chain W residue 104 type sequence I description BINDING SITE FOR RESIDUE SO4 W 155 source : CC3 4) chain W residue 105 type sequence T description BINDING SITE FOR RESIDUE SO4 W 155 source : CC3 5) chain W residue 56 type sequence E description BINDING SITE FOR RESIDUE TRS W 156 source : DC5 6) chain W residue 84 type sequence T description BINDING SITE FOR RESIDUE TRS W 156 source : DC5 7) chain W residue 85 type sequence S description BINDING SITE FOR RESIDUE TRS W 156 source : DC5 8) chain W residue 23 type ACT_SITE sequence Y description Proton acceptor => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI1 9) chain W residue 103 type ACT_SITE sequence H description Proton donor => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI2 10) chain W residue 77 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI3 11) chain W residue 83 type BINDING sequence H description BINDING => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI3 12) chain W residue 90 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI3 13) chain W residue 104 type BINDING sequence I description BINDING => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI3 14) chain W residue 114 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI3 15) chain W residue 18 type SITE sequence R description Transition state stabilizer => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links