eF-site ID 3kip-S PDB Code 3kip Chain S click to enlarge Title Crystal structure of type-II 3-dehydroquinase from C. albicans Classification LYASE Compound 3-dehydroquinase, type II Source Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) (Q59Z17_CANAL) Sequence S:  LVKKVLLINGPNLNLLGTRYGTTSLSDIEQAAIEQAKLKN NDSEVLVFQSNTEGFIIDRIHEAKRQGVGFVVINAGAYTH TSVGIRDALLGTAIPFIEVHITNVHQREPFRHQSYLSDKA VAVICGLGVYGYTAAIEYALNYQL Description Functional site 1) chain S residue 77 type sequence N description BINDING SITE FOR RESIDUE SO4 S 155 source : BC8 2) chain S residue 103 type sequence H description BINDING SITE FOR RESIDUE SO4 S 155 source : BC8 3) chain S residue 104 type sequence I description BINDING SITE FOR RESIDUE SO4 S 155 source : BC8 4) chain S residue 105 type sequence T description BINDING SITE FOR RESIDUE SO4 S 155 source : BC8 5) chain S residue 56 type sequence E description BINDING SITE FOR RESIDUE TRS T 156 source : DC4 6) chain S residue 84 type sequence T description BINDING SITE FOR RESIDUE TRS T 156 source : DC4 7) chain S residue 85 type sequence S description BINDING SITE FOR RESIDUE TRS T 156 source : DC4 8) chain S residue 18 type SITE sequence R description Transition state stabilizer => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI4 9) chain S residue 23 type ACT_SITE sequence Y description Proton acceptor => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI1 10) chain S residue 103 type ACT_SITE sequence H description Proton donor => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI2 11) chain S residue 77 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI3 12) chain S residue 83 type BINDING sequence H description BINDING => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI3 13) chain S residue 90 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI3 14) chain S residue 104 type BINDING sequence I description BINDING => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI3 15) chain S residue 114 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_03136 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links