eF-site ID 3kay-AB PDB Code 3kay Chain A, B click to enlarge Title Crystal structure of abscisic acid receptor PYL1 Classification SIGNALING PROTEIN Compound Putative uncharacterized protein At5g46790 Source Arabidopsis thaliana (Mouse-ear cress) (Q8VZS8_ARATH) Sequence A:  SEFTQLSQSIAEFHTYQLGNGRCSSLLAQRIHAPPETVWS VVRRFDRPQIYKHFIKSCNVSEDFEMRVGCTRDVNVISGL PANTSRERLDLLDDDRRVTGFSITGGEHRLRNYKSVTTVH RFERIWTVVLESYVVDVPEGNSEEDTRLFADTVIRLNLQK LASITEAMNR B:  SEFTQLSQSIAEFHTYQLGNGRCSSLLAQRIHAPPETVWS VVRRFDRPQIYKHFIKSCNVSEDFEMRVGCTRDVNVISGL PANTSRERLDLLDDDRRVTGFSITGGEHRLRNYKSVTTVH RFEKEEERIWTVVLESYVVDVPEGNSEEDTRLFADTVIRL NLQKLASITEAMNRN Description Functional site 1) chain A residue 86 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 2) chain A residue 116 type BINDING sequence A description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 3) chain A residue 143 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 171 type BINDING sequence E description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 5) chain B residue 86 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 6) chain B residue 116 type BINDING sequence A description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 7) chain B residue 143 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 8) chain B residue 171 type BINDING sequence E description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 115 type SITE sequence P description Involved in interactions with PP2Cs => ECO:0000269|PubMed:19855379 source Swiss-Prot : SWS_FT_FI2 10) chain B residue 115 type SITE sequence P description Involved in interactions with PP2Cs => ECO:0000269|PubMed:19855379 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 182 type SITE sequence S description Involved in interactions with PP2Cs => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI3 12) chain B residue 182 type SITE sequence S description Involved in interactions with PP2Cs => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links