eF-site ID 3k6l-ABC PDB Code 3k6l Chain A, B, C click to enlarge Title The structure of E.coli peptide deformylase (PDF) in complex with peptidomimetic ligand BB2827 Classification HYDROLASE Compound Peptide deformylase Source Escherichia coli (strain K12) (DEF_ECOLI) Sequence A:  SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYA EEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEK SGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFEL EADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEK LDRL B:  SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYA EEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEK SGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFEL EADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEK LDRL C:  VLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAE EGIGLAATQVDIHQRIIVIDDERLVLINPELLEKSGETGI EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLL AICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVE Description Functional site 1) chain A residue 50 type sequence Q description BINDING SITE FOR RESIDUE NI A 169 source : AC1 2) chain A residue 90 type sequence C description BINDING SITE FOR RESIDUE NI A 169 source : AC1 3) chain A residue 132 type sequence H description BINDING SITE FOR RESIDUE NI A 169 source : AC1 4) chain A residue 136 type sequence H description BINDING SITE FOR RESIDUE NI A 169 source : AC1 5) chain A residue 42 type sequence E description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 6) chain A residue 43 type sequence G description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 7) chain A residue 44 type sequence I description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 8) chain A residue 45 type sequence G description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 9) chain A residue 50 type sequence Q description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 10) chain A residue 86 type sequence I description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 11) chain A residue 89 type sequence G description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 12) chain A residue 90 type sequence C description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 13) chain A residue 91 type sequence L description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 14) chain A residue 97 type sequence R description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 15) chain A residue 129 type sequence C description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 16) chain A residue 132 type sequence H description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 17) chain A residue 133 type sequence E description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 18) chain A residue 136 type sequence H description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 19) chain B residue 50 type sequence Q description BINDING SITE FOR RESIDUE NI B 169 source : AC3 20) chain B residue 90 type sequence C description BINDING SITE FOR RESIDUE NI B 169 source : AC3 21) chain B residue 132 type sequence H description BINDING SITE FOR RESIDUE NI B 169 source : AC3 22) chain B residue 136 type sequence H description BINDING SITE FOR RESIDUE NI B 169 source : AC3 23) chain B residue 42 type sequence E description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 24) chain B residue 43 type sequence G description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 25) chain B residue 44 type sequence I description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 26) chain B residue 45 type sequence G description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 27) chain B residue 50 type sequence Q description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 28) chain B residue 86 type sequence I description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 29) chain B residue 88 type sequence E description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 30) chain B residue 89 type sequence G description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 31) chain B residue 90 type sequence C description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 32) chain B residue 91 type sequence L description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 33) chain B residue 129 type sequence C description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 34) chain B residue 132 type sequence H description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 35) chain B residue 133 type sequence E description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 36) chain B residue 136 type sequence H description BINDING SITE FOR RESIDUE 2BB B 170 source : AC4 37) chain C residue 50 type sequence Q description BINDING SITE FOR RESIDUE NI C 169 source : AC5 38) chain C residue 90 type sequence C description BINDING SITE FOR RESIDUE NI C 169 source : AC5 39) chain C residue 132 type sequence H description BINDING SITE FOR RESIDUE NI C 169 source : AC5 40) chain C residue 136 type sequence H description BINDING SITE FOR RESIDUE NI C 169 source : AC5 41) chain A residue 45 type catalytic sequence G description 98 source MCSA : MCSA1 42) chain A residue 50 type catalytic sequence Q description 98 source MCSA : MCSA1 43) chain A residue 90 type catalytic sequence C description 98 source MCSA : MCSA1 44) chain A residue 91 type catalytic sequence L description 98 source MCSA : MCSA1 45) chain A residue 132 type catalytic sequence H description 98 source MCSA : MCSA1 46) chain A residue 133 type catalytic sequence E description 98 source MCSA : MCSA1 47) chain A residue 136 type catalytic sequence H description 98 source MCSA : MCSA1 48) chain B residue 45 type catalytic sequence G description 98 source MCSA : MCSA2 49) chain B residue 50 type catalytic sequence Q description 98 source MCSA : MCSA2 50) chain B residue 90 type catalytic sequence C description 98 source MCSA : MCSA2 51) chain B residue 91 type catalytic sequence L description 98 source MCSA : MCSA2 52) chain B residue 132 type catalytic sequence H description 98 source MCSA : MCSA2 53) chain B residue 133 type catalytic sequence E description 98 source MCSA : MCSA2 54) chain B residue 136 type catalytic sequence H description 98 source MCSA : MCSA2 55) chain C residue 45 type catalytic sequence G description 98 source MCSA : MCSA3 56) chain C residue 50 type catalytic sequence Q description 98 source MCSA : MCSA3 57) chain C residue 90 type catalytic sequence C description 98 source MCSA : MCSA3 58) chain C residue 91 type catalytic sequence L description 98 source MCSA : MCSA3 59) chain C residue 132 type catalytic sequence H description 98 source MCSA : MCSA3 60) chain C residue 133 type catalytic sequence E description 98 source MCSA : MCSA3 61) chain C residue 136 type catalytic sequence H description 98 source MCSA : MCSA3 62) chain A residue 133 type ACT_SITE sequence E description ACT_SITE => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI1 63) chain B residue 133 type ACT_SITE sequence E description ACT_SITE => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI1 64) chain C residue 133 type ACT_SITE sequence E description ACT_SITE => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI1 65) chain A residue 90 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 66) chain A residue 132 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 67) chain A residue 136 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 68) chain B residue 90 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 69) chain B residue 132 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 70) chain B residue 136 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 71) chain C residue 90 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 72) chain C residue 132 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 73) chain C residue 136 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links