eF-site ID 3k6l-A PDB Code 3k6l Chain A click to enlarge Title The structure of E.coli peptide deformylase (PDF) in complex with peptidomimetic ligand BB2827 Classification HYDROLASE Compound Peptide deformylase Source Escherichia coli (strain K12) (DEF_ECOLI) Sequence A:  SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYA EEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEK SGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFEL EADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEK LDRL Description Functional site 1) chain A residue 50 type sequence Q description BINDING SITE FOR RESIDUE NI A 169 source : AC1 2) chain A residue 90 type sequence C description BINDING SITE FOR RESIDUE NI A 169 source : AC1 3) chain A residue 132 type sequence H description BINDING SITE FOR RESIDUE NI A 169 source : AC1 4) chain A residue 136 type sequence H description BINDING SITE FOR RESIDUE NI A 169 source : AC1 5) chain A residue 42 type sequence E description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 6) chain A residue 43 type sequence G description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 7) chain A residue 44 type sequence I description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 8) chain A residue 45 type sequence G description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 9) chain A residue 50 type sequence Q description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 10) chain A residue 86 type sequence I description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 11) chain A residue 89 type sequence G description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 12) chain A residue 90 type sequence C description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 13) chain A residue 91 type sequence L description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 14) chain A residue 97 type sequence R description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 15) chain A residue 129 type sequence C description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 16) chain A residue 132 type sequence H description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 17) chain A residue 133 type sequence E description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 18) chain A residue 136 type sequence H description BINDING SITE FOR RESIDUE 2BB A 170 source : AC2 19) chain A residue 45 type catalytic sequence G description 98 source MCSA : MCSA1 20) chain A residue 50 type catalytic sequence Q description 98 source MCSA : MCSA1 21) chain A residue 90 type catalytic sequence C description 98 source MCSA : MCSA1 22) chain A residue 91 type catalytic sequence L description 98 source MCSA : MCSA1 23) chain A residue 132 type catalytic sequence H description 98 source MCSA : MCSA1 24) chain A residue 133 type catalytic sequence E description 98 source MCSA : MCSA1 25) chain A residue 136 type catalytic sequence H description 98 source MCSA : MCSA1 26) chain A residue 133 type ACT_SITE sequence E description ACT_SITE => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 90 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 132 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 29) chain A residue 136 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links