eF-site ID 3jyc-A PDB Code 3jyc Chain A click to enlarge Title Crystal structure of the eukaryotic strong inward-rectifier K+ channel Kir2.2 at 3.1 Angstrom resolution Classification METAL TRANSPORT Compound Inward-rectifier K+ channel Kir2.2 Source (3JYC) Sequence A:  NRFVKKNGQCNVEFTNMDMFTTCVDIRWRYMLLLFSLAFL VSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFV AAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCI IDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCL MWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDI DVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETD DFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVL FEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSN S Description Functional site 1) chain A residue 145 type sequence G description BINDING SITE FOR RESIDUE K A 501 source : AC1 2) chain A residue 145 type sequence G description BINDING SITE FOR RESIDUE K A 501 source : AC1 3) chain A residue 145 type sequence G description BINDING SITE FOR RESIDUE K A 501 source : AC1 4) chain A residue 145 type sequence G description BINDING SITE FOR RESIDUE K A 501 source : AC1 5) chain A residue 146 type sequence Y description BINDING SITE FOR RESIDUE K A 501 source : AC1 6) chain A residue 146 type sequence Y description BINDING SITE FOR RESIDUE K A 501 source : AC1 7) chain A residue 146 type sequence Y description BINDING SITE FOR RESIDUE K A 501 source : AC1 8) chain A residue 146 type sequence Y description BINDING SITE FOR RESIDUE K A 501 source : AC1 9) chain A residue 144 type sequence I description BINDING SITE FOR RESIDUE K A 502 source : AC2 10) chain A residue 144 type sequence I description BINDING SITE FOR RESIDUE K A 502 source : AC2 11) chain A residue 144 type sequence I description BINDING SITE FOR RESIDUE K A 502 source : AC2 12) chain A residue 144 type sequence I description BINDING SITE FOR RESIDUE K A 502 source : AC2 13) chain A residue 145 type sequence G description BINDING SITE FOR RESIDUE K A 502 source : AC2 14) chain A residue 145 type sequence G description BINDING SITE FOR RESIDUE K A 502 source : AC2 15) chain A residue 145 type sequence G description BINDING SITE FOR RESIDUE K A 502 source : AC2 16) chain A residue 145 type sequence G description BINDING SITE FOR RESIDUE K A 502 source : AC2 17) chain A residue 143 type sequence T description BINDING SITE FOR RESIDUE K A 503 source : AC3 18) chain A residue 143 type sequence T description BINDING SITE FOR RESIDUE K A 503 source : AC3 19) chain A residue 143 type sequence T description BINDING SITE FOR RESIDUE K A 503 source : AC3 20) chain A residue 143 type sequence T description BINDING SITE FOR RESIDUE K A 503 source : AC3 21) chain A residue 144 type sequence I description BINDING SITE FOR RESIDUE K A 503 source : AC3 22) chain A residue 144 type sequence I description BINDING SITE FOR RESIDUE K A 503 source : AC3 23) chain A residue 144 type sequence I description BINDING SITE FOR RESIDUE K A 503 source : AC3 24) chain A residue 144 type sequence I description BINDING SITE FOR RESIDUE K A 503 source : AC3 25) chain A residue 143 type sequence T description BINDING SITE FOR RESIDUE K A 504 source : AC4 26) chain A residue 143 type sequence T description BINDING SITE FOR RESIDUE K A 504 source : AC4 27) chain A residue 143 type sequence T description BINDING SITE FOR RESIDUE K A 504 source : AC4 28) chain A residue 143 type sequence T description BINDING SITE FOR RESIDUE K A 504 source : AC4 29) chain A residue 82-106 type TRANSMEM sequence MLLLFSLAFLVSWLLFGLIFWLIAL description Helical; Name=M1 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 107-123 type TOPO_DOM sequence IHGDLENPGGDDTFKPC description Extracellular source Swiss-Prot : SWS_FT_FI2 31) chain A residue 152-156 type TOPO_DOM sequence TEECP description Extracellular source Swiss-Prot : SWS_FT_FI2 32) chain A residue 124-128 type INTRAMEM sequence VLQVN description source Swiss-Prot : SWS_FT_FI3 33) chain A residue 129-142 type INTRAMEM sequence GFVAAFLFSIETQT description Helical; Pore-forming; Name=H5 source Swiss-Prot : SWS_FT_FI4 34) chain A residue 143-151 type INTRAMEM sequence TIGYGFRCV description Pore-forming source Swiss-Prot : SWS_FT_FI5 35) chain A residue 157-181 type TRANSMEM sequence LAVFMVVVQSIVGCIIDSFMIGAIM description Helical; Name=M2 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links